KEGG   Geobacillus subterraneus: GS3922_11715Help
Entry
GS3922_11715      CDS       T04323                                 

Definition
(GenBank) glutathione-dependent formaldehyde dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
gsr  Geobacillus subterraneus
Pathway
gsr00010  Glycolysis / Gluconeogenesis
gsr00071  Fatty acid degradation
gsr00350  Tyrosine metabolism
gsr00625  Chloroalkane and chloroalkene degradation
gsr00626  Naphthalene degradation
gsr00680  Methane metabolism
gsr01100  Metabolic pathways
gsr01110  Biosynthesis of secondary metabolites
gsr01120  Microbial metabolism in diverse environments
gsr01130  Biosynthesis of antibiotics
gsr01200  Carbon metabolism
gsr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GS3922_11715
  09102 Energy metabolism
   00680 Methane metabolism
    GS3922_11715
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GS3922_11715
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GS3922_11715
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GS3922_11715
   00626 Naphthalene degradation
    GS3922_11715
Enzymes [BR:gsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GS3922_11715
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     GS3922_11715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 KN17_SH3 FtsJ Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AMX84275
UniProt: A0A143MJT9
Position
complement(2391819..2392955)
Genome map
AA seq 378 aa AA seqDB search
MKAVTYQGIKDVAVKQMPDPKILKDDDIIVKITSTAICGSDLHLVHGMVPNMPEDFIIGH
EPMGIVEEVGPAVTKVKKGDRVVVPFTIACGQCWYCQHGLESQCDASNPNGESGAYFGYS
ETFGGYPGGQAEYLRVPFANFTPFVVPDDCELEDEKLLFLSDVIPTAFWGVDEAGVKDGD
TVVVLGCGPVGLLAQKFAWLKGAKRVIAVDYIDYRLEHAKKTNKVETINFTEYENTGEYM
KELTGGGADVVIDCVGLDGKMTPLELIGSALKLQGGAMGAIVIASQAVRKGGTIQLVGVY
GSRYNQFPLGDLFSRNVTLKMGQAPVIHYIPMLYEWIVEGKFDPTDIITHRLPLDEAQYA
YEIFDEKKDGCIKVVLKP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtgacatatcaaggcattaaagatgtcgcggtgaaacaaatgccagatccg
aaaattttgaaggatgatgatattattgtaaaaatcacaagcaccgccatttgcggctct
gatcttcatctcgtgcacggcatggtcccgaacatgccggaagattttattatcggccat
gagccgatgggcatcgtcgaggaagtcgggccggcggtgacgaaagtcaaaaaaggcgac
cgtgtcgtcgtgccgtttacgattgcctgtggacaatgctggtattgccagcacgggctt
gagagtcaatgtgacgcgtcaaacccaaacggcgagtcgggggcgtatttcggctattcc
gaaacgtttggcggctacccgggcgggcaagctgaatatttgcgcgtgccgtttgccaac
ttcaccccgtttgtcgtccccgacgattgtgaattggaagatgaaaaattattgtttttg
tccgacgttattccgaccgcgttttggggcgtcgacgaagcgggagtgaaagacggcgac
acagtcgtcgtgctcggctgcgggccggtcgggctgttggcgcaaaagttcgcttggctg
aaaggagcgaagcgcgtcatcgctgttgattacatcgattaccggcttgagcacgcgaaa
aagacgaataaagtagagacgatcaactttaccgaatacgaaaacaccggtgaatacatg
aaggagctgaccggcggcggggcggatgtagtcatcgattgcgtcggcctagacggaaaa
atgaccccgcttgagctcatcggctcggcgctgaagctgcaagggggcgcgatgggggcg
atcgtcatcgcctcgcaggcggtgcgcaaaggcggaacgattcagctcgtcggagtgtat
ggctcccgctacaaccagtttccgcttggcgatttattttcacgcaacgttacgctgaaa
atggggcaggcgccggtcattcattacattccgatgctgtatgagtggattgtcgaagga
aagtttgacccgaccgatattattacgcatcgccttccactcgatgaggcacaatatgcg
tatgaaattttcgatgaaaagaaagacggctgcatcaaagtcgtgctgaagccgtaa

DBGET integrated database retrieval system