KEGG   Bacillus sp. X1(2014): HW35_06165Help
Entry
HW35_06165        CDS       T03242                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00010  Glycolysis / Gluconeogenesis
gst00020  Citrate cycle (TCA cycle)
gst00620  Pyruvate metabolism
gst01100  Metabolic pathways
gst01110  Biosynthesis of secondary metabolites
gst01120  Microbial metabolism in diverse environments
gst01130  Biosynthesis of antibiotics
gst01200  Carbon metabolism
Module
gst_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HW35_06165
   00020 Citrate cycle (TCA cycle)
    HW35_06165
   00620 Pyruvate metabolism
    HW35_06165
Enzymes [BR:gst01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     HW35_06165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AIM15959
UniProt: A0A077J334
Position
1175100..1176686
Genome map
AA seq 528 aa AA seqDB search
MNTVHIPNELKLLLNADNVHVQLSVPQLVEKILNRNEGLLTSTGAVRVSTGKYTGRSPQD
KFIVSEASTKDKIDWGSLNQPISEEVFTNLYNKVLDYLKQQNEIFVFKGFAGADKKSRLP
IQVINEFAWHNLFAHQLFIRPTEEELLSHEAEFTVISAPNFKADPKVDGTNSETFIIISF
ERRIVLIGGTEYAGEMKKSIFSVMNYLLPENNIFSMHCSANVGAEGDVALFFGLSGTGKT
TLSADPNRKLIGDDEHGWSSNGVFNIEGGCYAKCINLSREKEPQIFDAIRFGTVLENVVI
DQESRIPDYNDGTLTENTRAAYPIEAIDNIIQPSIAGHPNTIVFLTADAFGVLPPIAKLT
KEQAMYHFLSGYTSKLAGTERGVTSPQATFSTCFGAPFLPLPATRYAEMLGEKILEHNVN
VFLVNTGWTGGEYGVGQRMKLSYTRAMVQAALEGELNNVETIKDEIFGLNIPLHIPGVPD
EVLQPQKTWADPKAYEIKAKELAAKFRENFKKFKDVGPEIEEKGGPIA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgttcatattccaaatgaattaaaacttctattaaatgcagataatgtccat
gttcaattatccgttcctcagttagtggaaaaaattttaaaccgtaatgaggggttatta
acttctaccggagcagtacgagtttcaacaggtaaatatactggtcggtcaccacaagat
aaatttattgtttcagaagcgtctacaaaagataaaattgattggggctcccttaaccaa
ccaatctctgaagaagtttttactaacttatataataaagtattggattacttaaaacaa
caaaatgaaatatttgttttcaaaggcttcgcaggagctgataaaaaatcccgcctaccg
attcaagtgatcaatgagtttgcatggcataatttatttgcccaccaattatttatccgt
ccaactgaggaagaattactttcacatgaggcggaatttacagttatttctgcgccaaat
tttaaagcagatcctaaggtggatggaactaattctgaaacattcattatcatttccttt
gaacgtcgaattgttttaattggcggtacagaatatgcaggtgaaatgaaaaaatccatt
ttctctgtaatgaattatttgctacctgagaacaatattttctccatgcactgctccgca
aatgttggtgctgaaggggatgttgcattattctttggcttatccggaacgggtaagact
accctttccgctgatccgaaccgtaagttaattggtgatgatgagcatggctggtcatca
aatggcgtgttcaatatcgagggcggttgttatgcaaaatgcatcaatctatcacgtgaa
aaggaaccgcaaatttttgatgcaatccgctttggaacggttcttgaaaatgtggttatc
gaccaagaatctcgaattccggattataatgatggaacactaactgaaaatacccgtgcc
gcttatccaatcgaagcgattgataatattattcagcctagcattgcaggccatccgaat
accattgtattcttaacagctgatgcttttggtgtattacctccaattgctaaattaaca
aaagaacaagcaatgtatcacttcttaagcggttatacatcaaaacttgctggtactgaa
cgtggtgtaacatcaccacaagctacattctctacttgctttggcgctccattccttcca
cttccggcaacacgctatgctgaaatgctaggagaaaaaattcttgagcacaatgtaaat
gtctttttagtaaatacaggctggactggcggagaatatggcgtgggtcaaagaatgaag
ctttcttacacaagagccatggtgcaagctgcacttgaaggtgaattaaacaatgtggag
actatcaaggatgaaatctttggtttaaatattccacttcatatccctggagtaccagat
gaagttcttcagccacaaaaaacatgggctgatccgaaagcatatgaaattaaggcgaaa
gaacttgcagccaaattccgagaaaactttaagaagtttaaagacgtaggaccagaaatt
gaagaaaaaggcggaccaattgcctaa

DBGET integrated database retrieval system