KEGG   Bacillus sp. X1(2014): HW35_09730Help
Entry
HW35_09730        CDS       T03242                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00071  Fatty acid degradation
gst00072  Synthesis and degradation of ketone bodies
gst00280  Valine, leucine and isoleucine degradation
gst00310  Lysine degradation
gst00362  Benzoate degradation
gst00380  Tryptophan metabolism
gst00620  Pyruvate metabolism
gst00630  Glyoxylate and dicarboxylate metabolism
gst00640  Propanoate metabolism
gst00650  Butanoate metabolism
gst00900  Terpenoid backbone biosynthesis
gst01100  Metabolic pathways
gst01110  Biosynthesis of secondary metabolites
gst01120  Microbial metabolism in diverse environments
gst01130  Biosynthesis of antibiotics
gst01200  Carbon metabolism
gst01212  Fatty acid metabolism
gst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HW35_09730
   00630 Glyoxylate and dicarboxylate metabolism
    HW35_09730
   00640 Propanoate metabolism
    HW35_09730
   00650 Butanoate metabolism
    HW35_09730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HW35_09730
   00072 Synthesis and degradation of ketone bodies
    HW35_09730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HW35_09730
   00310 Lysine degradation
    HW35_09730
   00380 Tryptophan metabolism
    HW35_09730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HW35_09730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HW35_09730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HW35_09730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gst04147]
    HW35_09730
Enzymes [BR:gst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HW35_09730
Exosome [BR:gst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HW35_09730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIM16519
UniProt: A0A077J4U6
Position
complement(1867893..1868987)
Genome map
AA seq 364 aa AA seqDB search
MKRAVIVLAKRTPIGKVKGILRDIQPHELVAPLLQYLANRLEDKINDIILGNVVGPGGNI
ARVAALEAGLPLSVTGLTIDRQCSAGLEAIRMACYYIQGGAGCCYIAGGVESASTSPFPS
RARFSPEQIGDPDMGVAAENVAEKYSISKELQDRYALLSYERTWEAYEKGYFTQEIIPIK
ENHQDEELLRKRNLETLLKRAKPIFKKNGTVTAANSCGIHDGASAVLVMEEKVALKLGYQ
PILRFLDSEVSAVHPNYPGEAPIPAIQTLLKRNLLTVADIDLIEINEAFSSKIVACMKEL
SIPCDKINVHGGALTLGHPYGASGSILITRLFYEVQRRKNAKYVLAALGSAGGIGEAVLF
EVAT
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
attaaaagagcagtcattgtcctagcgaaacgtacaccaattggaaaagtaaaaggaata
ttacgagatattcagccgcatgaacttgtcgctccactcctccagtatttagcgaataga
ttggaagataagataaatgacattattttggggaatgttgttggaccaggtggaaatata
gctagggtagctgcattggaagcaggattacctctttctgtaacaggacttaccattgat
cgtcaatgcagtgcgggattagaagccattcgaatggcctgttactatatccaaggcgga
gccggctgttgttatattgctggtggtgtagaaagtgcaagtacttctccatttccatcc
agagcaagattctcacctgaacaaattggcgaccctgatatgggtgttgccgcggaaaat
gtagcagaaaaatattctatatcaaaagaattacaggatagatacgcacttttaagttac
gagcgcacttgggaggcgtacgaaaaggggtattttactcaagaaatcattccgattaag
gaaaaccaccaggatgaagaattacttagaaaaagaaatctggaaactctactaaaaagg
gcgaaaccaatatttaaaaaaaacggtacagttactgcagcgaacagttgtggtattcat
gacggtgcttcagctgttcttgtcatggaagaaaaagtagctttaaaacttggttaccag
cctatcctgagatttttggacagtgaagtctcagctgtacatcctaattatcccggggaa
gcccctattccagctatccaaaccttattaaaaagaaacttgttaaccgttgctgatata
gatttaattgaaattaatgaagcattttcttcgaagatagtcgcctgtatgaaagaactt
tctattccttgtgacaaaataaatgttcacggaggagctttaacgttaggacatccttat
ggggcttcaggaagtattttgatcaccaggcttttctatgaagtccaaagacgaaagaat
gctaaatatgtactagcggcactgggcagtgctggaggaatcggagaagcagtcctattc
gaggtggcaacatga

DBGET integrated database retrieval system