KEGG   Bacillus sp. X1(2014): HW35_11780Help
Entry
HW35_11780        CDS       T03242                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00250  Alanine, aspartate and glutamate metabolism
gst00330  Arginine and proline metabolism
gst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HW35_11780
   00330 Arginine and proline metabolism
    HW35_11780
Enzymes [BR:gst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     HW35_11780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIM16835
UniProt: A0A077J8C6
Position
2252175..2253722
Genome map
AA seq 515 aa AA seqDB search
MVQPYKHEPFTDFTVEENRQAYLQGLKTVEGYLGQEYPLIIGGERITTEEKIISYNPANK
EEVIGRVSKANKELAEKAMQAAVEAFKTWKKTKAEFRADVLFKAATIIRRRKHEFSALLT
KEAGKPWKEADADTAEAIDFLEYYGRQMLALKDGVPVNSRPNEFNRYHYIPLGVGIIISP
WNFPLAIMAGTTVAAIVTGNTVLLKPASTTPVVAAKFVEVMEEAGLPKGVLNFVPGSGAE
VGDYLVDHKDTRFISFTGSRDVGLRIFERSSKINPGQIWMKRLIAEMGGKDTIVVDSEAD
LELAAQSIVASAFGFSGQKCSACSRAVIVEDVYDQVLNRVVELTNELTVGDPTEQGTFMG
PVIDQNAFNKIMEYIEIGKSEGKLMTGGEGDDSKGYFIKPTVFADLDPKARIMQEEIFGP
VVGFTKAKNFDEAIEIANNTEYGLTGAVITKNRAHIEKAREDFHVGNLYFNRGCTGAIVG
YQPFGGFNMSGTDSKAGGPDYLLLHMQAKTTSEMF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaccttacaagcatgagccgtttacagattttacagttgaagagaaccgtcaa
gcttatcttcaagggttaaaaacagtagaaggatatttaggtcaagaatatccacttatc
attggcggtgagagaattaccaccgaggaaaaaatcatttcctataatccagcaaataaa
gaagaagtcattggccgcgtatcgaaagctaataaggaattagcagaaaaagcaatgcaa
gcggctgttgaggcatttaaaacttggaaaaaaacaaaggcagagttccgtgcagatgtg
ctttttaaagcagcaacgattatccgccgccgtaagcatgagttttctgctcttttaaca
aaagaagcagggaagccatggaaagaggcagatgctgacactgcggaagcaattgatttc
cttgaatattatggccgtcaaatgctggctctaaaagatggagtgccagtaaatagtcgt
ccaaatgaatttaaccgttatcattatattccactaggagtaggtatcatcatttctcct
tggaacttcccattagcgatcatggcaggtacgactgttgctgctattgttactggtaac
acggtattattaaaaccagcttcaactactccagttgtagcagcgaagtttgttgaggta
atggaagaagccggtcttcctaaaggggtattaaacttcgttccaggtagcggtgcagaa
gtgggcgattatttagttgaccataaggatactcgattcattagctttaccggttcacgt
gatgtaggacttcgcatttttgaacgttcttcaaaaattaatccaggacaaatctggatg
aagcgattaattgctgaaatgggcggtaaagacacaattgtcgtagactccgaagctgat
cttgaactagcagcacaatctatcgttgcatctgcatttggattctctggacaaaaatgc
tctgcatgttcacgtgccgtcattgttgaagatgtgtatgatcaagtattgaaccgcgtg
gttgaattaactaacgagttaaccgttggtgatccaacagaacaaggaactttcatggga
cctgttattgatcaaaacgccttcaataaaattatggaatatattgaaattggtaagagt
gaaggtaagttaatgactggtggtgaaggagacgattccaaaggatacttcattaaacca
actgtgtttgctgacctagatccgaaagcacgtattatgcaggaagaaatctttggacca
gtagtaggcttcactaaggcgaagaactttgatgaggctattgaaattgcaaataacact
gagtatggattaacaggcgctgttattactaaaaaccgtgctcatatcgaaaaggctcgt
gaagacttccatgttggaaacctctacttcaatcgtggctgtacgggtgctattgttggc
tatcagccattcggtggcttcaacatgtctggaaccgactcaaaagctggaggtccagac
tatctattactacacatgcaagctaaaacaacatctgaaatgttctaa

DBGET integrated database retrieval system