KEGG   Bacillus sp. X1(2014): HW35_13010Help
Entry
HW35_13010        CDS       T03242                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K16901  anthranilate 3-monooxygenase (FAD) / 4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.8 1.14.14.9]
Organism
gst  Bacillus sp. X1(2014)
Pathway
gst00350  Tyrosine metabolism
gst00380  Tryptophan metabolism
gst01100  Metabolic pathways
gst01120  Microbial metabolism in diverse environments
gst01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    HW35_13010
   00380 Tryptophan metabolism
    HW35_13010
Enzymes [BR:gst01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.8  anthranilate 3-monooxygenase (FAD)
     HW35_13010
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     HW35_13010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB
Motif
Other DBs
NCBI-ProteinID: AIM17041
UniProt: A0A077J845
Position
2501456..2502934
Genome map
AA seq 492 aa AA seqDB search
MGVRTGAQYIEGLKSRKPEVWLSGRKVTNVFEEPVFKQPILEIAKLYDMQHDPEYREQIT
HICEETGERANNAFLVPKSYEDLMKRRAVFEAFAKATFGLMGRTPDFLNVVVTSMYHNAW
FFEKYNKNWADNIRNYYKYLRDNDLFLTHAIINPQNDRSKSSHEQKDMFTHLGAVKETPD
GLVVRGAKMLATLAPITDEVIIYSFPGFKPGDERYALAFAIPIDTPGLRIICREPMQDGT
RSLFDHPLASRFEEMDALLVFDDVVVPWDRVFLYNNVEAANLLYPMTGAGQQPAHQSGVR
GLIKFQFATEVAMKLADSIGVDVYLNVQNDLGELAQSLESIRALLRVAELEYTITEHGEA
MPAYIPLETIRGLLPKMYPRAIEVLQIIGAGGLLMSPTGADFENEELRDSIENYYVGREG
VSSFDRVSLFKLAWDLCGEAFGQRLLQYERYYTGDPIRKRGIFYNNFKRMHSPDMVEEAL
KVSTLKKEMAAK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaagaacaggggcgcaatatattgaggggttaaaatcacgaaagccggaagtt
tggctttccggacggaaagtgacaaatgtttttgaggagcctgtatttaaacagccgatc
ttggaaattgccaagctgtatgatatgcagcatgatccagaatatcgcgaacaaattact
catatttgcgaagaaacaggagaaagagcgaacaacgcttttttagtgccaaaaagttat
gaggatctaatgaagcgcagagctgtatttgaagcatttgctaaggcaacatttggttta
atgggtagaacacctgactttttaaatgtcgtagttacctccatgtaccataatgcatgg
ttctttgaaaaatacaataaaaattgggcagataatattcgaaactattataagtacttg
cgtgataatgatttatttttaacccatgccatcataaacccacaaaatgaccgcagtaaa
tcatcccatgagcaaaaagatatgtttacccatctaggggctgttaaggaaacaccagat
ggtttggtggttcggggagcaaaaatgctggcgacccttgccccaatcacggatgaggtt
atcatttattccttcccaggatttaaaccaggagatgagcgttacgcattagcctttgcg
attccgatcgacacaccggggctccggattatttgtcgtgaaccaatgcaggatggaacc
cgctcattgtttgaccatccgctggcatcaagatttgaggaaatggatgccctattagtt
tttgatgatgtcgttgttccatgggatcgagtatttttatataacaatgtcgaagcggcg
aatctgctttatccaatgacgggtgcaggacagcagccggcccatcagtctggagtcaga
gggctgatcaagtttcaatttgcgacagaagtggccatgaagcttgctgattctatcggg
gtggatgtttatttgaatgtccaaaatgatttaggagaattagcacaatcgcttgaatcg
attagagcccttctaagagtggcggaactggaatatacgattaccgaacatggggaagcg
atgcctgcttatataccgcttgaaacgatcagaggactgcttccgaaaatgtatccccgt
gccattgaagtcttgcaaattatcggtgcaggtgggctgttaatgtcaccaaccggcgct
gattttgaaaatgaagaattaagagattctattgaaaattactatgttggaagagaagga
gtatcctcttttgaccgagtaagtctgtttaaactggcatgggatttatgtggagaagcg
tttggacagcgtctgcttcaatacgaacgatactatactggcgatccgatccggaaaaga
gggattttttacaataattttaaacgtatgcattcaccggatatggtggaagaagcgcta
aaagtaagtactttaaaaaaagaaatggcagcaaaataa

DBGET integrated database retrieval system