KEGG   Geobacter sulfurreducens PCA: GSU2101
Entry
GSU2101           CDS       T00155                                 

Name
(GenBank) glycerol dehydratase
  KO
K23121  trans-4-hydroxy-L-proline dehydratase [EC:4.2.1.172]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00330  Arginine and proline metabolism
gsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    GSU2101
Enzymes [BR:gsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.172  trans-4-hydroxy-L-proline dehydratase
     GSU2101
SSDB
Motif
Pfam: PFL-like Gly_radical DUF6042
Other DBs
NCBI-ProteinID: AAR35477
UniProt: Q74BE0
Position
complement(2311841..2314201)
AA seq 786 aa
MTERTRELRRRSLEARPAISAERALLLTEFYRENEGKYSVPVMRALSFLHICRHKTIWIG
EGELVVGERGPEPKAVPTYPELTCHSLEDLRILDSRPLTSYAVSAECLAAYEETVIPYWR
GRSLRDKMFGELAPEWHEAYAAGIFTEFMEQRAPGHTVLDEKPFRRGLLDFKADIAREIG
RLDFVQDGAAWEKREQLRAMAISCDAAILFAERHAGLADEMAARETDPHRKRELERIAEV
CRHVPAHAPRDFHEALQAYWFCHLAIITELNGWDAMSPGHLDQHLLPFYEQGLAHGSLSR
DAARELLECFFVKFNNHPAPPKVGVTAAESGTYTDFANINLGGLLPDGSDGSNEVSHLLL
DIIDEMHLLQPSSNIQLSRKSPDAFLSHALRVIRNGYGFPSIFNADSVVEEQLRQGKSLV
DARAGGCSGCVEVGAFGKEAYILTGYFNLVKLLELALHNGVDPRTGRQLGPASGDPSGFA
SFDDLYAAFEAQLRHFIEIKMAGNQLIEQIYCRLMPAPFLSVLIDDCIATGRDYNAGGAR
YNNTFIQGVGIGSITDSLSAIKALVYDSGHIALPDLVAALDADFAGQEPLRQRLLNRTSK
YGNDDDYADDLMRRVFESFFRTVDGRPNSKGGQYRIEMLPTTCHVYFGSVTGATPDGRRA
GTPLSEGISPVQGADRSGPTAVIKSAGKMDHIRTGGTLLNMKFAPSLVEGEQGISTMASL
VRSYFRMDGHHVQFNVVRADTLRAAQADPDAHRDLIVRVAGYSDYFCDLSRELQDEIITR
TEHDSL
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgaccgagcgcacacgggaactgcgccgcaggagcctggaggcacgccccgccatttcc
gccgaacgggcgctgctgctgaccgaattttaccgggaaaacgaggggaaatactcggtg
ccggtgatgcgcgccctgtcgttcctccatatctgccgtcataagaccatctggatcggg
gagggcgaactggtcgtgggcgagcggggtcctgaacccaaggcggtccccacctatccc
gaactgacctgtcacagcctggaagacctgcgtattctcgattcgcgtcccctgacgagc
tatgccgtttccgccgagtgcctcgccgcctacgaggaaacggtgatcccctactggcgg
gggcgctccctgcgggacaagatgttcggcgaactggccccggaatggcacgaggcgtac
gccgcaggcatcttcaccgaattcatggaacagcgcgccccgggtcacacggtcctggac
gagaagcccttccggcgcggcctgctggatttcaaggccgacattgcccgggagatcggg
cggctcgacttcgtgcaggacggcgcggcctgggagaagcgcgagcagctcagggccatg
gccatttcctgcgacgcggccatcctctttgccgagcggcatgccggcctggccgacgag
atggcggcgcgggagacggatccgcaccggaagcgggaacttgagcgcatcgccgaggtc
tgccgccatgtgccggcccatgcgccgcgcgacttccacgaagcgctccaggcctactgg
ttctgccacctggcaatcatcaccgagctgaacgggtgggacgccatgagccccggccac
ctggaccagcacctgctgccgttctacgagcagggtctggcccacggctccctgtcgcgg
gatgcggcgcgggagctgctggaatgcttcttcgtcaagttcaacaaccacccggccccc
cccaaggtgggagtcaccgccgccgagagcggcacctacaccgatttcgccaacatcaac
ctgggcggtctgctgcccgacggttccgacggctccaacgaggtgtcccacctcctgctc
gacatcatcgacgagatgcacctgctccagcccagcagcaacatccagctctcccgcaag
tctcccgacgccttcctgagccatgccctgcgtgtcatcaggaacgggtacggctttcct
tccatcttcaacgccgacagcgtggtggaggagcagttgcgccagggcaagagcctggtg
gacgcccgggccggcggctgcagcggctgcgtcgaggtgggggcgttcggcaaagaggcc
tacatcctgaccggctacttcaacctggtgaagctcctggaactggccctgcacaacggc
gtcgaccctcgcaccggcaggcagctgggcccggccagcggcgatccctccggttttgcc
tccttcgacgacctctacgccgccttcgaggcgcagctgcggcatttcatcgagatcaag
atggcgggcaaccagctgatcgaacaaatctactgccgcctcatgccggcgccgttcctg
tcggtgctgatcgacgactgcatcgcaaccggcagggactacaacgccggcggggcgcgc
tacaacaacaccttcatccagggcgtggggatcggcagcatcaccgactcactgtccgcc
atcaaggcgctggtctacgactccggccacattgcgctgccggacctggtggccgcactt
gacgccgattttgcggggcaggagccgctacgccagcgcctgctcaacaggaccagcaaa
tacggcaacgacgacgactacgccgacgaccttatgcgccgggtcttcgagagcttcttc
aggaccgtcgatggccggcccaacagcaagggtgggcagtaccggatcgagatgctcccc
accacctgtcacgtctacttcggctcggtcaccggcgcaaccccggacgggcgccgggcc
ggcaccccgctctcggagggtatctccccggtccagggggcggatcgctccgggccgacc
gcggtcatcaaatcggccggcaagatggaccacatcagaaccggcggcaccctgctcaac
atgaagtttgccccctccctcgtggaaggggagcaggggatcagcacaatggccagcctc
gtgcggagctatttccgcatggacgggcaccacgtccagttcaacgtcgtgcgcgccgac
acgctccgcgccgcccaggccgaccccgatgcccaccgcgacctgatcgtgcgcgtggcg
ggctacagcgactacttctgcgacctgtcgcgggaactgcaggacgagatcatcacgcgt
accgagcatgatagtctctga

DBGET integrated database retrieval system