KEGG   Geobacter sulfurreducens PCA: GSU0430
Entry
GSU0430           CDS       T00155                                 

Gene name
tssE
Definition
(RefSeq) type VI secretion system needle hub protein TssE
  KO
K11905  type VI secretion system protein
Organism
gsu  Geobacter sulfurreducens PCA
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gsu02044]
    GSU0430 (tssE)
Secretion system [BR:gsu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GSU0430 (tssE)
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-GeneID: 2686443
NCBI-ProteinID: NP_951489
UniProt: Q74G22
Position
459166..459573
AA seq 135 aa
MREERLLERIRSLERDPSRRGGTDRGRLVDSILAHVRRIINTRRGSVPIAPDFGIPDMLD
VLQSYPDSVREIERSIRAAIQGFEPRLADVRVAFVPQEDDVLALRFAISARLGSDGGAVC
FETLVDTDGKVTVRR
NT seq 408 nt   +upstreamnt  +downstreamnt
atgcgcgaagaacgccttctggaacgtatccgctccctggagcgggatccgtcgcgccgc
ggggggactgatcggggccgtctggtggattcaatcctggcacacgtccgccggattatt
aacacgcgccgggggagcgtgcctatcgcccctgacttcggcatccctgacatgctcgac
gtgcttcagagctacccagattcggtgcgggagatcgaacggagcatccgtgccgccatc
cagggctttgagccgcgtctcgccgacgtaagggttgccttcgtcccgcaggaggacgac
gtgctggcgctccggtttgccatctccgcccggcttggcagcgacggcggagcggtctgt
tttgaaacgctggtggataccgacgggaaggttacggtgagacgttga

DBGET integrated database retrieval system