KEGG   Geobacter sulfurreducens PCA: GSU0573Help
Entry
GSU0573           CDS       T00155                                 

Definition
(RefSeq) zinc-containing alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00010  Glycolysis / Gluconeogenesis
gsu00071  Fatty acid degradation
gsu00350  Tyrosine metabolism
gsu00625  Chloroalkane and chloroalkene degradation
gsu00626  Naphthalene degradation
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01130  Biosynthesis of antibiotics
gsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU0573
  Lipid metabolism
   00071 Fatty acid degradation
    GSU0573
  Amino acid metabolism
   00350 Tyrosine metabolism
    GSU0573
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GSU0573
   00626 Naphthalene degradation
    GSU0573
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GSU0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 2685437
NCBI-ProteinID: NP_951631
UniProt: Q74FN3
Position
601208..602200
Genome map
AA seq 330 aa AA seqDB search
MRAMLFEEVGKPLRPVRVPVPEPGPGEVLLKVHACGICRTDVHIVDGELTEPALPLIPGH
QIVGSVAKLGEGVERFREGTRVGVPWLGATCGACRYCRSGRENLCDHARFTGYQRDGGFA
EFTVADARFCFPIPGGYPDLQAAPLLCAGLIGYRSLVMAGEGERLGIYGFGAAAHIVTQV
ARFRGWRVYAFTRPDDRAGQAFAREMGAVWAGASHERPPEELDAAIIFAPAGELVPAALR
AVGKGGVVVCGGIHMSDIPPIPYDILWGERSIRSVANLTRRDGEEFLALAPKVPVRTEVT
AYPLSAANEALDDLRRGRLRGAGVLVIDEG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatgctgttcgaggaggtgggaaaaccgctgcggccggtccgggtgccggtc
cccgaaccggggccgggcgaggtgctgctcaaggttcacgcctgcggtatctgccggacg
gatgttcacatcgtggacggcgagctgacggagcccgccctgccgctcatccccggccac
cagatcgtggggagcgtggcaaagctgggggagggggtcgagcgtttccgggaggggacg
cgggtgggggtcccctggctcggcgccacctgcggcgcctgccgctactgccggtcggga
cgggaaaacctgtgcgaccacgcccggttcaccgggtatcagcgcgacggcggctttgcc
gagttcaccgttgccgatgcccgcttctgctttccgatccccgggggatacccggacctc
caggcggcgccgctgctctgcgccgggctcatcggctaccgctccctggtcatggccggt
gagggggaacggctgggcatttatggcttcggcgccgcggcccacatcgtgacccaggtg
gcccgcttccggggatggcgggtctacgccttcacccgtcccgacgaccgtgccggccag
gcctttgcccgggagatgggagcggtctgggccggggcctcccacgagcggccgcccgag
gagcttgacgccgccatcatcttcgcgcccgccggagagctggtgccggcggcgctgcgg
gcggtgggcaaggggggcgtcgtggtctgcggcggcatccacatgagcgacatcccgccg
atcccctacgatatcctctggggggagcggagcatccgctccgtggccaacctgacccgg
cgcgacggggaggaattcctcgccctggcgccgaaggtgcccgtcaggaccgaggtgact
gcctatcccctcagcgcggccaacgaagccctcgacgacctgcggcgcgggcgcctgcgg
ggcgccggcgtcctggtgatcgacgagggataa

DBGET integrated database retrieval system