KEGG   Geobacter sulfurreducens PCA: GSU0582Help
Entry
GSU0582           CDS       T00155                                 

Gene name
mcp40H-2
Definition
(RefSeq) methyl-accepting chemotaxis sensory transducer, class 40H dimer with helix-swapped heme-binding site-containing PAS domain
  KO
K03406  methyl-accepting chemotaxis protein
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu02020  Two-component system
gsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GSU0582 (mcp40H-2)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    GSU0582 (mcp40H-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:gsu02035]
    GSU0582 (mcp40H-2)
Bacterial motility proteins [BR:gsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    GSU0582 (mcp40H-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP PhageMin_Tail Goodbye DUF1664 YkyA DUF948 ALIX_LYPXL_bnd
Motif
Other DBs
NCBI-GeneID: 2685861
NCBI-ProteinID: NP_951640
UniProt: Q74FM4
Structure
PDB: 

Position
613600..615690
Genome map
AA seq 696 aa AA seqDB search
MFRTRLAFKVLAIIGITLFLGFAALGITSIWLEYNAIMDLQTRNTRGLSTLVVRDIGELM
MAGDMAVIERYVADVRGKGAVLDLRIYDAAGRPAGKKQDAPDGEVQAALTSGATAEKRHK
VDGRHVLSFIVPLANEVRCQSCHEQGARFNGAMLLTTSLEEGYAGARNLTLALALVGVCS
FFLLLGVMYLFFNRVIIRNIGEISRRVQEIAQGEGDLTASVPVRSSDELGVLAEGINLLV
TKLREIISGLYHQAGHIAISACRTIKETERLVASTHEQKDLSTSVAVASEEMAATLNDVA
VNTQRAAQLSLSVDRAAHEGMATVTETAESIDRIKDSVMATLDTMDKLQQSSGQIGEIVG
IIGDIADQTNLLALNAAIEAARAGDSGKGFAVVANEVKVLSDRTASSTREIGTIIRSIQA
EIRAVVASIAEGKDKVEVGVERSTTARRQLEDILRLAAESTDMINQIATATEEQSATTGE
ISEKISQVSGTAERVNGQMEQTAGIFRELSETAEQIYGTVGRFKVGTYHDTVKGLASEMR
DRVVATLERAASDRRVTLDALFSSEYTPIPDTFPQKYRTPSDRLFDEIISPIQEEILGRD
SGMYYAICVDRRGYCPSHNLRYSRPLTGNREADKEHNRTKRIFEDRTGLRCAGNTGSFLL
QTYLRDTGEVMNDLSVPIVIGGRHWGAVRIGYRADD
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaacgagacttgccttcaaggttctcgccattatcggtataactctgttttta
gggtttgccgccctcggaatcacctctatctggcttgaatacaacgcaatcatggatctc
cagacccgcaacacccgcgggctctcgaccctggtggtccgtgacatcggcgaactcatg
atggcgggtgacatggccgtcattgagcgctacgtggccgacgttcgaggcaagggtgcc
gttctcgacctgcgcatctatgatgccgcgggaaggccggccggcaaaaagcaggatgcg
cccgacggagaggtgcaggcggccctgacctccggggccactgcggaaaagcgtcacaag
gtggacgggcggcacgtgctgagctttatcgttcccctggccaatgaggtgcgctgtcag
tcgtgccatgagcagggcgcccgcttcaatggcgccatgcttctcacaacgtcgctggag
gaaggatacgccggcgcccggaacctgaccctggccctggccctggtgggcgtatgctcg
ttctttctcctccttggcgtgatgtacctgtttttcaatcgggtcatcatcaggaatatc
ggtgagatatcgagacgggtgcaggaaatcgcccagggtgagggggaccttaccgcctcc
gtgccggtgcgttcaagcgacgaactcggggttctggccgagggaatcaaccttcttgta
accaagctcagggagattatctcgggcctgtatcaccaggccggacatatcgccatttcc
gcctgccgcaccatcaaggaaaccgagcggctggtggcctccacccacgagcagaaggat
ctgtccacgtcagtggcggttgcctccgaggagatggcggcaacactcaacgatgtcgcc
gtcaatacccagcgggcagcccagctgtccctttccgtggaccgggccgcccatgagggg
atggccaccgtgacggagaccgccgagagtatcgaccggatcaaggacagcgtcatggca
acgctcgacaccatggacaagctgcagcagtcgtcgggccagatcggtgagattgtcggc
atcatcggggacatcgccgaccagaccaacctcctggcgctcaacgcggcaatagaagcg
gcccgggcgggagactcgggcaagggattcgcggtggtggccaatgaggtgaaggtactg
tcggaccggactgcctcctccacccgggaaatcgggaccatcatcaggagcattcaggcg
gagatccgcgcggtggtggcatccattgccgaagggaaggacaaggtcgaggtgggcgtc
gaacggtcaactacggcgcggcggcagctggaggatatcctgcgcctggcggctgagtcc
acggacatgatcaaccagatcgccacggcaacagaggagcagagcgccaccaccggcgag
atatccgaaaagatatcccaggtttcgggcacggctgaacgggtaaacggccagatggag
cagacggcgggaatcttccgggagctctcggagacggccgagcagatttacggcaccgtg
gggcggttcaaggtggggacctatcacgatacggtcaaagggctggcgtcggagatgcgc
gaccgggtcgtcgcgacgcttgagcgggccgcgtcggatcggcgcgttactcttgatgcg
ctgttcagcagcgagtacacgccgatccccgacaccttcccccagaaataccgcacgccc
tcagaccggctcttcgacgagattatttcaccgatccaggaggagatcctggggcgcgac
agcggcatgtactacgccatctgcgttgaccggcgcggttactgtccttcccataacctc
cgctattcgcgccctcttaccggcaaccgggaggcggacaaggagcataaccggaccaaa
cggatttttgaggatcgtacggggctgcggtgcgcgggcaatacggggagtttcctgctg
cagacctacctgcgggacacgggcgaggtgatgaatgacctttcagtgccgattgttatc
ggcggcaggcactggggtgccgtgaggatcggctaccgggccgacgattga

DBGET integrated database retrieval system