KEGG   Geobacter sulfurreducens PCA: GSU1448Help
Entry
GSU1448           CDS       T00155                                 

Definition
(RefSeq) metal-dependent phosphoesterase, PHP family
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
gsu  Geobacter sulfurreducens PCA
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GSU1448
Enzymes [BR:gsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     GSU1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C
Motif
Other DBs
NCBI-GeneID: 2687782
NCBI-ProteinID: NP_952499
UniProt: Q74D71
Position
complement(1586705..1587571)
Genome map
AA seq 288 aa AA seqDB search
MKLIDLHVHSYHSDGVLAPAVLVAMAAERGLASLAIADHDAVDGIDEAVAEGVRLGVDVI
PAVELSVELGRFSDLHILGYCIDHHDPAFRDKLAGFRSARDNRGKAILEKINRRLLHSRK
APLSYDEVLSMAGGAVGRPHIGRVLVDNGYARDMEDAFRRYLIPCNVPKRYMPAGEAIAE
IRRIGGVSVLAHPPTITDDRRRLRQVVEQLAQLGLDGLEVFNNLCFKDDMLYLERLAEEF
GLLMTGGSDFHGFEDDVELGRGRGGLAVAHSLAEKVKELAAQRKHSHA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatcgatcttcacgttcactcataccattccgacggagttcttgccccggcc
gtcctggtcgccatggccgccgagcgagggctggcatcgctcgccattgccgatcacgat
gccgttgacggcattgacgaggccgtggcggaaggcgtgcggctcggcgtcgacgtcatc
cccgccgtggagctttccgttgaactgggacgcttcagcgacctgcacattctcggctac
tgcattgatcaccacgatccagcctttcgcgataaactcgccggcttcaggtccgcgcgc
gacaaccggggcaaggcgatcctcgaaaagatcaaccgccggctgctccactcccgcaag
gcgcccctttcctatgatgaggtcctttccatggccggcggcgccgtgggtcggcctcat
atcggccgcgtactggtcgataatgggtatgcgcgggacatggaagacgcctttcggcgc
tatctgatcccctgtaacgtaccgaagcgttacatgccggccggcgaggcaattgccgaa
atccgccgcattggcggcgtgtcggtgttagcgcaccccccgaccattaccgatgaccgg
cgccggttgcgacaggttgtcgaacaactggcgcagctggggcttgacggactcgaagtg
ttcaacaacctctgcttcaaggacgacatgctctacctcgaacgcctcgccgaggaattc
gggctgctgatgacgggaggatccgacttccacggcttcgaggacgacgtggagctgggg
cgcggccgcggcggtcttgccgttgcccacagcttggcggaaaaagtaaaagaactggca
gcgcaacgaaaacactcccacgcctga

DBGET integrated database retrieval system