KEGG   Geobacter sulfurreducens PCA: GSU1702Help
Entry
GSU1702           CDS       T00155                                 

Definition
(RefSeq) ROK domain transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00010  Glycolysis / Gluconeogenesis
gsu00052  Galactose metabolism
gsu00500  Starch and sucrose metabolism
gsu00520  Amino sugar and nucleotide sugar metabolism
gsu00521  Streptomycin biosynthesis
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01130  Biosynthesis of antibiotics
gsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU1702
   00052 Galactose metabolism
    GSU1702
   00500 Starch and sucrose metabolism
    GSU1702
   00520 Amino sugar and nucleotide sugar metabolism
    GSU1702
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GSU1702
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GSU1702
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GSU1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N
Motif
Other DBs
NCBI-GeneID: 2687247
NCBI-ProteinID: NP_952753
UniProt: Q74CH1
Position
1864391..1865347
Genome map
AA seq 318 aa AA seqDB search
MIRPAFIGMDIGGTNLRMGLVDEAGTILFRFRQKTDIHEGRAAFYEKLAEGIGILKEHAE
QAGFRIVAVGAGVPGLVANDGHIHVSVNLPAIDSINLRHDLERISGLPATVANDVNATAY
GEKSFGAGREFDSFLMVTLGTGVGGGLILNGRLWTGIDGVAGEFGHVTVEPQGTSCPCGN
RGCLEQYASATAIASAAREAMMTGRYVPADGSAIPLTTQDLARLAREGDGAAATFFAEAG
RYLGMATASLANVLNLEALIVGGGVAASFDLIRSSIEREVRARAFPIPAQRLVVVRGALG
DDGGLLGSAALARDEFDI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcccggcgttcatcggcatggatatcggtgggaccaatctgcggatgggactc
gtcgacgaggcgggaacgatccttttccgcttcaggcagaaaaccgatattcatgagggg
agagccgccttttacgaaaagctcgccgaggggataggcattctcaaagagcacgcagag
caggcgggattccgcatcgtggcagttggtgccggcgttccggggcttgtggcaaatgac
ggacatatccacgtatcggtgaatcttccggccattgacagcatcaacctccgccatgac
ctggaacgcatcagtggtctgccggcgacggtggccaacgatgtcaacgccaccgcgtac
ggcgagaaatccttcggtgccggacgcgagttcgactcgttcctgatggttacactcggc
accggcgtcggaggagggctcatcctgaacgggcggctgtggaccggaatcgacggcgta
gccggcgagttcggtcatgtgacggtcgagccccaggggacgtcctgtccctgcggcaac
cggggttgtcttgagcaatatgcctctgccacggccatagcctcagccgcgcgagaggcc
atgatgacggggcgatacgtaccggctgacgggtctgcgatacctctcactacccaggat
ctggcccgtctcgcccgggaaggggatggtgcggcggcgacatttttcgccgaggcggga
cgttatctgggcatggcaacggcatcactggccaacgtactcaatctggaagcactgatc
gttggtgggggcgtcgctgcaagctttgatctgatcaggagttccatagagcgagaggtt
cgtgcccgagctttcccgattccggcccagcggctggtggtggtccgtggcgcattgggc
gacgacggaggactcctgggaagcgctgcgctggcccgtgatgagttcgacatctaa

DBGET integrated database retrieval system