KEGG   Geobacter sulfurreducens PCA: GSU1815Help
Entry
GSU1815           CDS       T00155                                 

Gene name
uxs
Definition
(RefSeq) UDP-glucuronate decarboxylase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00520  Amino sugar and nucleotide sugar metabolism
gsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GSU1815 (uxs)
Enzymes [BR:gsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     GSU1815 (uxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR UDPG_MGDP_dh_N NmrA
Motif
Other DBs
NCBI-GeneID: 2686299
NCBI-ProteinID: NP_952865
UniProt: Q74C60
Position
complement(1980538..1981473)
Genome map
AA seq 311 aa AA seqDB search
MRILVTGGAGFIGSHLCERLLEQGHDVLCLDNFFTGSKRNIDRLMDFHRFEVIRHDIIEP
ILLEVDRIYNLACPASPVHYQYNPVKTIKTSVMGTINMLGLAKRVRARILQASTSEVYGD
PTIHPQPESYWGNVNPIGIRSCYDEGKRVAETLLMDYHRQNGVDIRIARIFNTYGPRMAE
HDGRVVSNFVVQALRGEDLTVYGDGSQTRSFCYVDDLLDGLVTLMEHDQFCGPVNLGNPE
ETPIIEFARRIIAMTGSSSQIIYRPLPSDDPRQRQPDITLARTILGWEPRVSLDEGLAKT
IEYFAGLTPTG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctggtaaccggcggcgccggattcatcggttctcatctgtgcgaacggctt
ctggagcaggggcatgacgtgctctgcctcgacaactttttcaccgggtcgaaacgcaat
atcgatcggctgatggattttcatcgtttcgaggtcatccgtcacgatatcatcgagccg
atcctgctggaagtggaccggatctacaatctggcgtgccctgcttcgcccgttcactac
cagtacaatccggtaaagaccatcaagaccagcgtgatgggaaccatcaacatgctgggg
cttgccaagcgcgtcagggcgcgcatcctccaggcatccacttcggaggtctatggcgat
cccacaattcatccccagcccgaatcctactggggaaacgtgaacccgatcggcatccgg
agctgctacgacgagggaaaacgggtggcggaaaccctcttgatggactaccatcgccag
aatggtgtcgacatccggatcgcccgcatcttcaacacctatggcccgcggatggcagaa
cacgatgggcgagtggtttccaatttcgtggtgcaggccctccggggagaagatctcacc
gtgtacggcgacggcagccagacccgttccttctgctatgtggacgacctgctggacggg
ctcgtgacgctcatggagcatgatcagttctgcgggcccgtaaatcttggaaacccggaa
gagacacccattatcgagtttgcccggcggatcattgcgatgaccggttcgtcctcgcag
atcatctatcggccgctcccttccgacgatcctcgccagcgtcagcccgacatcaccctg
gcccgaacgatccttggctgggagcctcgcgtatccctcgacgaggggcttgcaaaaacc
attgagtactttgccggcctgaccccgaccggatag

DBGET integrated database retrieval system