KEGG   Geobacter sulfurreducens PCA: GSU2371Help
Entry
GSU2371           CDS       T00155                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00260  Glycine, serine and threonine metabolism
gsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01130  Biosynthesis of antibiotics
gsu01230  Biosynthesis of amino acids
Module
gsu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU2371 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GSU2371 (trpA)
Enzymes [BR:gsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GSU2371 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth ThiG BtpA DUF561 NanE TMP-TENI Dus
Motif
Other DBs
NCBI-GeneID: 2686600
NCBI-ProteinID: NP_953418
UniProt: Q74AI3
Position
complement(2598075..2598869)
Genome map
AA seq 264 aa AA seqDB search
MSRIAGTFAELKHNSRKALVTFITAGDPDLAATEALIPLLAESGADIVELGVPFSDPMAD
GPTIQLSSERALAAGTTLPKILDMVRRVRTRCQVPIVLMGYYNPILIHGLERFAADASAA
GVDGVLLVDLPPEEAAEFKACADRHGLDVIFLLTPTSDEGRIRKVARQARGFVYYVSVTG
VTGARSGVEASVSSNVAAIREAITVPVVVGFGISTPDQAAQVAASADGVVVGSAIVKLFE
RFTAAELGREVATFVSALREAIGN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattgccggcacatttgccgaattgaagcacaacagccgcaaggccctcgtt
accttcatcaccgccggtgacccggacctggccgccacggaagcgctgattccgcttctg
gctgaaagcggcgccgacatcgtggaacttggcgttcccttttcggatccaatggccgac
ggccccaccatccagctttcttccgagcgggcccttgctgcggggacgaccctgccgaag
atcctcgacatggtgcgccgggtccgtacccgctgccaggtgcccatcgtgctcatgggc
tactacaatccgattctgatccacggccttgagcgctttgcggcggatgcctcggccgcg
ggggtcgacggcgtgctcctggttgaccttcccccggaggaggcggccgagttcaaggca
tgtgccgaccgccacgggctcgatgttatcttccttctcacccccacctccgacgaaggg
cgcatccggaaagtggcgcggcaggcccgcgggttcgtctactatgtgtcggtgaccggc
gtgaccggcgcgcggagcggcgtggaggcgtccgtttcctccaacgtggccgccattcgc
gaggcgatcaccgtgccggtcgtggtcggcttcggcatctcgacgcctgaccaggctgcc
caggtggccgcctcggccgacggcgtggtcgtggggagcgccattgtaaaattgttcgag
cgtttcacggccgccgagctcgggcgtgaggtcgcaaccttcgtttccgcgctgcgcgaa
gcgatcggaaattga

DBGET integrated database retrieval system