KEGG   Geobacter sulfurreducens PCA: GSU2656Help
Entry
GSU2656           CDS       T00155                                 

Gene name
bkdF
Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E2 subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00010  Glycolysis / Gluconeogenesis
gsu00020  Citrate cycle (TCA cycle)
gsu00620  Pyruvate metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01130  Biosynthesis of antibiotics
gsu01200  Carbon metabolism
Module
gsu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU2656 (bkdF)
   00020 Citrate cycle (TCA cycle)
    GSU2656 (bkdF)
   00620 Pyruvate metabolism
    GSU2656 (bkdF)
Enzymes [BR:gsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GSU2656 (bkdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_D23 GCV_H
Motif
Other DBs
NCBI-GeneID: 2685633
NCBI-ProteinID: NP_953701
UniProt: Q749T6
Position
2927238..2928416
Genome map
AA seq 392 aa AA seqDB search
MPYDFKLPDLGEGITEAELRRWLVKEGDTVAEHQPVVEVETDKAVVEVPSPRAGRVITRA
RLEGETVMVGETLLTIAEEEATPPVRKPSVGIVGELPEAEEAVGTQQPAILATPLVRKLA
RERGIDLATVRGSGPRGSITPEDVAGAGAPARPDAGEFGPAERIPLRGVRRSIARNVMTS
QRNTAFVTGMEEADITELWHLREREQQAVEQRGTHLTFLPFFIKAVQHALREHPYLNAAI
DDVAGEIILKKHYHFGIAVETPDGLMVPVIRNVDAKSIIELASELQELGRKARERTITLD
EMRGSTFTLTNFGHFGGVFATPVINWPDVAILGFGRIADRPWVHAGQIVVRTILPLSLTF
DHRVTDGADAAQFLSKVVRYLEDPALLFIESI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatgacttcaagctccccgatctgggcgaagggataaccgaggcggaactgcgc
cgctggctcgtgaaggaaggggataccgtagccgagcaccagccggtggtggaggtggag
accgacaaggcagtggtggaggtcccctcgccccgagccgggagggtgataacgcgtgcc
cggctggaaggggaaaccgtcatggtcggagagacgctcctcaccatcgctgaagaggaa
gcgactccccccgtgcggaaaccctccgtggggatcgtgggcgaactccccgaggcggag
gaagcagtcgggacacagcagccggccatcctcgccacccccctggtcaggaaactggcc
cgggaacggggcatcgacctggcaaccgtgcggggaagcggcccgcgggggagcattacc
cccgaagacgtggcgggcgcgggcgccccggcccggccggatgccggcgagttcgggccg
gcggagcggattcccctgcggggagtgcggcggtccatcgcccggaacgtcatgacctcc
cagcggaacaccgcctttgtcaccggcatggaagaggcggacatcaccgaactgtggcac
ctgcgggaacgggagcagcaggcggtggaacagcggggcacccacctcaccttcctcccc
ttcttcatcaaggccgtccagcacgccctgcgggagcatccctacctgaatgccgccatt
gacgacgtggccggagaaatcatcctcaaaaagcactatcacttcggcattgccgtggag
acccccgacggcctcatggtgccggtaatccgcaacgtggacgccaagagcatcatcgaa
ctggcttcggaactccaggaactgggccgcaaggcccgggagaggaccatcaccctggac
gaaatgcggggcagcaccttcaccctcaccaacttcggccacttcgggggcgtgttcgcc
acccccgtcatcaactggcccgacgtggccatcctcggtttcggccgcattgccgaccgt
ccatgggtccacgccggccagatcgtcgtccgcacgatccttcccctgtccctcaccttc
gaccaccgggttaccgacggagccgacgcggcccagttcctgagcaaggtcgtccgctac
ctggaagatccggcactcctgtttattgaaagcatctga

DBGET integrated database retrieval system