KEGG   Geobacter sulfurreducens PCA: GSU2974Help
Entry
GSU2974           CDS       T00155                                 

Gene name
metF-2
Definition
(RefSeq) bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00270  Cysteine and methionine metabolism
gsu00670  One carbon pool by folate
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GSU2974 (metF-2)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    GSU2974 (metF-2)
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     GSU2974 (metF-2)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     GSU2974 (metF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-GeneID: 2687368
NCBI-ProteinID: NP_954016
UniProt: Q748M7
Position
complement(3265444..3267261)
Genome map
AA seq 605 aa AA seqDB search
MTFLERLHDEVLIGDGAIGTMLYAKGVSLDANVEHLNLVRPSLVLELHREYLAAGARVIE
TNTFGANWTRLAAIGLEKKEREINLRGAQLAREAAQGTDAFVAGSVGPLVRMKGDEQELS
AQETVDIFRRQTHALAEGEVDLLILETFTDLAQMRHALTAARETGLPVVANMAFLENGRL
AGGIEVERVAVELTAAGACVVGANCGAGPLEILGTIQRMGRVTDLPLAAYPNSGFPEYVN
GRHVYRTTPDYFADRAVEMVGAGAALVGGCCGTTPEHVRCLAQRLAGLRPAARTVAVSAL
PKDERRPESREYAGFLARWGREPIVTVELDPPKGLDCAKIIEGSRALREAGADAINIAEN
PLARIRMGNIALGSLIQREAGIDVIVHVTCRDRNLLGLQSDLMGASLLGIRHVLAVTGDP
ARIGEQAGATSVYDLNSFGLIKLLADLNAGVNALGSPIGGGTGFVIGAAFNPNSARMEVQ
VERLARKVANGARFVQTQPLYDVARLEEMAERTAHLGIPILPGILPLVSERNCEFLHNEV
PGIVIPEEIRHRMRGKEKEDGVREGLAIAREFIDAVRDRVGGFYLIPPFGKYGIAVELTR
YIKGT
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgacctttctcgaacggctgcatgacgaggtcctcatcggcgacggagccatcggcacc
atgctttatgccaagggggtatccctcgacgccaacgttgagcacctgaacctggtgcgc
ccgtcgctggtgctggaactccaccgggagtacctggcggccggggcccgcgttatcgaa
accaacaccttcggcgccaactggacccggctcgcggccatcggtcttgagaagaaggag
cgtgagatcaacctccggggtgcccaactggcccgggaggccgcccagggcaccgacgcc
ttcgtggccggctccgtggggcccctggtccggatgaagggggacgaacaggaactctcc
gcccaagaaaccgtcgacatcttccggaggcagacccatgccctggccgagggggaggtg
gatctcctgatcctggagaccttcaccgatctggcgcagatgaggcacgccctgaccgcg
gcccgggaaacggggctgccggtggtggccaacatggcgttcctggaaaacgggagactc
gccggcgggatcgaggtggagcgggtagccgtggagctgactgccgccggtgcctgcgtg
gtgggcgccaactgcggcgccgggccattggaaatcctcggcaccatccagcggatgggc
cgggtgacggatcttcccctggcggcctatcccaacagcggatttcccgaatacgtgaac
ggccgccatgtctaccggaccacccctgattacttcgcggaccgggccgtggagatggtc
ggggcgggagcggcactggtggggggatgctgcggcaccacgccggagcacgtgcggtgc
ctggcgcagcggctggcggggctgcggcccgcggcacgcacggttgccgtttccgccctg
cccaaggatgagcgcagaccggagtcccgcgagtatgccggcttcctggcccgctgggga
cgtgagcccattgtcaccgtggagctggatccgcccaaggggctcgactgcgcgaagatc
atcgaggggagcagggcgctgcgggaggctggggcggacgccatcaacatcgccgagaac
ccgctggcccggatccggatgggtaacatcgccctggggagcctcattcagcgggaggcg
ggaatcgacgtcattgttcacgtgacctgccgggaccgcaacctgctggggctccagtcg
gacctcatgggggcgagcctgttggggattcgccacgtgctggccgtcaccggtgatccc
gcccgtatcggcgaacaggccggggccacatcggtgtacgatctgaattccttcggcctc
atcaagctgctggccgatttgaacgccggagtgaacgctctgggctcgcccataggcgga
gggacggggttcgtcatcggagccgctttcaatcccaacagcgcccggatggaggtccag
gtggagcgcttggccaggaaggtggccaacggcgcccgttttgtccaaacccagcccctc
tatgatgtggcgcggctggaggagatggcggagcggacggcgcacctgggtatccccatc
ctgcccggaattctgccactggtgagcgagcgcaactgcgaatttctccataacgaggtg
ccgggcatcgtgatccccgaagaaatccggcaccggatgcggggaaaggaaaaagaggac
ggagtgagggaaggcctcgccatcgcccgggagttcattgatgcggtgcgggaccgggtg
ggcggattctacctcatccctcccttcggcaaatacggtattgccgtggagttgacgcgg
tacatcaaggggacctga

DBGET integrated database retrieval system