KEGG   Geobacter sulfurreducens PCA: GSU3073Help
Entry
GSU3073           CDS       T00155                                 

Gene name
murF
Definition
(RefSeq) UDP-N-acetylmuramylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase
Organism
gsu  Geobacter sulfurreducens PCA
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 2686304
NCBI-ProteinID: YP_006589581
UniProt: I7F9Q4
Position
complement(3379715..3381127)
Genome map
AA seq 470 aa AA seqDB search
MLFTLDDILGATGGEIVAGGETIGASGVSTDSRTVEPGELFIPLRGERFDGHDYLDAARA
RGVRLTLVERQWLAGRQLPADVTCIVVDDTLRALGDLAACHRRRFDIPVVAVTGSNGKTT
TKEMLAAILARTGEGLKTEGNLNNLIGVPRMLFRLSGVHRWAVLEIGMSEFGEIDRLAEI
VRPDVGIITNAYPAHLETLGSVEGVARAKGELFLRLEPGSSAVYNADDPLIARCPSPEGV
KRVSFGLRGGDVTAEDVENLGKKGQRFTLRLPNGRVTVTLHAFGSHNVANALAAAAAARV
LGVAPEEIARGLGEFMPYARRFNLEEVGDVVLIDDSYNANPASMAAALTTLREIKGSGRA
VAVLGDMLELGIGAEEAHRQLGRLAATCVDRLYVLGAMAGTVAAGALEGGLEERHVTIAA
DHGEIVADLRRTAATGEMILVKGSRGMAMDRVAEGIREAFAASGGKGGHV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtttacgctcgatgacatactgggggctacaggcggggagatcgtggcgggaggc
gagacaatcggagcctccggcgtttccaccgattcgcgtaccgtggagcccggcgagctc
ttcatcccgttgcggggtgagcgatttgacgggcacgattacctggacgcggcacgtgcc
cggggtgtgcggctgaccctggttgagcggcagtggctggcggggcgtcagctcccggcc
gatgtgacctgtattgtcgtggacgacacgttgcgggcgttgggcgacctggcggcatgc
caccgtcggcggtttgacatccccgttgtggcggtgaccgggagcaatggcaagaccacc
accaaggagatgttggcggcgattctggcccggaccggcgagggactgaagacggagggg
aacctcaataacctgatcggtgtgccccgcatgctgttccggctctccggggtccaccgg
tgggcggtgctggaaatagggatgagcgaattcggtgagatcgaccggctcgccgagatc
gttcggcccgacgtgggtatcatcaccaatgcctatccggcacacctggaaaccctcggc
agcgtggaaggggttgcccgggccaagggggaactctttttgaggcttgagccgggctcc
agtgccgtctataacgccgatgacccgctcattgcccgctgtcccagccctgaaggagtg
aagcgcgtctcttttgggctcaggggcggcgacgtgacagcggaagacgtggagaatctg
gggaaaaaagggcagcggttcacgttacggttgcccaacggtcgtgtcaccgttaccttg
cacgcctttggcagccacaatgtggccaacgccttggccgccgctgcagcagcccgcgtg
ctcggcgttgcgcccgaggagatcgcccgtgggctcggcgaattcatgccctatgctcgg
cgcttcaacctggaagaagtgggggacgtggtgctgatcgacgacagctacaacgccaat
ccagcctctatggccgcagccctgaccaccttgcgggagatcaaagggagcggccgggcc
gtcgcggtgctgggtgacatgcttgaactgggtatcggagcagaagaagctcatcggcaa
ttggggcggctggccgccacgtgcgtcgaccggctctacgtgcttggtgccatggcgggg
accgttgccgccggtgcccttgaaggggggctggaagagcgccacgtaacgatcgccgcc
gatcacggcgagattgttgccgatctgcggcggacggctgcaacgggcgagatgattctg
gtgaagggctcccgcggcatggccatggatcgggtcgccgagggaatcagagaggcgttc
gccgcctccggcggcaaagggggccacgtctaa

DBGET integrated database retrieval system