KEGG   Geobacter sulfurreducens PCA: GSU3162Help
Entry
GSU3162           CDS       T00155                                 

Gene name
ltaA
Definition
(RefSeq) L-allo-threonine aldolase, stereospecific
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00260  Glycine, serine and threonine metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01130  Biosynthesis of antibiotics
gsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU3162 (ltaA)
Enzymes [BR:gsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     GSU3162 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 2686763
NCBI-ProteinID: NP_954203
UniProt: Q747V3
Position
3468240..3469286
Genome map
AA seq 348 aa AA seqDB search
MNIIDLRSDTVTRPSPAMRAAMAGAEVGDDVYGEDPTVNRLEELGAATLGTEAALFTASG
TQANLLALLAHCRRGDEYIAGQTAHCYRYEGGGAAALGGIQPQPLEVEPDGTLDLSAVAA
AIKPDDLHFARTRLLCLENTHAGRVLPLDYLARARRLCNEQSLGLHMDGARIFNAAVKLG
VPVREIAGHVDSVSVCLSKGLGAPVGSLLCGGREFVATARRWRKAVGGGMRQAGILAAAG
ILALTENVDRLAEDHANARRLAEGLAAIPGLGLDPSQVQTNMVFLCLPLRTADRLASFLN
EQGILISGRESIRLVTHLDVTSSDVERVIAAFGAFFAGHGEMQPGASS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcattgacctgcgcagcgacaccgttacccggccgagccctgccatgcgcgcc
gccatggcgggagccgaggtaggggacgacgtctatggcgaagacccgaccgtgaaccgg
ctggaggaactgggcgccgccacgctcggcacggaagcggccctgttcaccgccagcggt
acccaggccaatcttctggctctcctggcccactgccggcgtggtgacgaatacattgcc
ggccagaccgcccactgctatcgctacgaagggggcggtgccgccgctttggggggcatc
cagccccagcccctggaggtggaacccgacgggaccctcgatctctcagccgtggccgcc
gccatcaagccggacgacctccacttcgcccgcacccggctcctctgcctggaaaacacc
catgccgggcgggttcttcccctggactacctggcacgcgccagacggctctgcaacgag
cagagccttggcctgcacatggacggtgcccgcatcttcaatgccgccgtaaagctcggc
gtaccggtccgcgagatcgccggtcacgtggattcggtgtcggtctgcctctccaagggg
ctcggcgccccggtggggtcgctgctctgcgggggaagggagttcgtcgccacggcccgc
cggtggcgcaaggcggtcggaggaggcatgcgccaggccggcatcctggcggccgccggc
atcctggcgctgaccgaaaacgttgaccggctcgccgaggaccatgccaacgcccgccgc
ttggccgaggggttggccgccatcccggggctgggccttgacccgtcccaggtccagacc
aacatggtattcctgtgcctccctctccggacggcggaccggctcgcctcatttctcaac
gaacagggaattctcatctccggccgggaaagtatccgtctcgtcacccaccttgacgta
acctcttcggacgtggaacgggttatcgcggcattcggcgcattcttcgccggccacggc
gagatgcaaccgggagcatcgtcatga

DBGET integrated database retrieval system