KEGG   Geobacter sulfurreducens PCA: GSU3308Help
Entry
GSU3308           CDS       T00155                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00230  Purine metabolism
gsu00250  Alanine, aspartate and glutamate metabolism
gsu01100  Metabolic pathways
Module
gsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSU3308 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GSU3308 (purA)
Enzymes [BR:gsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     GSU3308 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 2686657
NCBI-ProteinID: NP_954348
UniProt: Q747F9
Position
3632442..3633743
Genome map
AA seq 433 aa AA seqDB search
MANVVVVGAQWGDEGKGKVVDIYTEHADDVVRYQGGNNAGHTLVVGEEKVVLHLIPSGIL
HEGKRCIIGNGVVLDPEVFIQEITRLKDKGRLKDDRALLVSESIHIIMPYHKRIDIAREA
KSGEKKIGTTGRGIGPTYEDKIGRRGIRLMDLLDRDVFARKLKENLEEKNVILEKLLGDK
PFTFEEIYEQYCGYADILRNYVADTSLILYNDSKAGKKLLFEGAQGTLLDVDHGTYPFVT
SSSTCAGGACTGTGVSPRDIHEIIGISKAYVTRVGSGPFPTELLDADGEKLRQVGHEFGA
TTGRPRRCGWFDAMVVRYAVRVNGLTGVALTKLDVLNDFETIKVCTGYTFEGKPLADLPA
NLAVFEKCEPVYEELPGWMSDISGARTFEELPEKAKSYVKRLEQLIGCPIVLVSIGPRRD
QTIIISNPFQDKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgtggttgtggttggtgcccagtggggcgacgaaggcaagggcaaggtcgtt
gacatctataccgagcatgcggacgacgtggtccgttaccaggggggaaacaacgccggg
cacaccctggtcgttggggaagaaaaggtggtcctgcacctgatcccctcgggcattctc
cacgagggtaaacggtgcatcatcggcaacggcgtggttctcgaccccgaggtcttcatc
caggagatcacccgcctcaaggacaagggccgcctcaaggacgaccgcgcgctcctggtc
agcgaatcgatccacatcatcatgccctaccacaaacggatcgacatcgcccgcgaagcc
aagagcggcgaaaagaaaatcggtaccaccggccgggggatcggccccacctatgaggac
aaaatcggccggcgcggtatccggctcatggacctcctcgatcgcgacgtgtttgcgcgc
aagttgaaggaaaacctcgaagagaagaacgtcatcctcgaaaaactcctgggcgacaag
ccctttacctttgaggagatttacgagcagtactgcggctacgccgacatcctcagaaac
tacgtggccgacacaagcctcatcctttacaacgacagcaaggccggcaagaaactcctc
ttcgagggagcccaggggacactcctcgacgtggaccacggcacttacccctttgtcaca
tcctcatccacctgtgcaggcggtgcctgtaccggcaccggcgtgagcccccgggacatc
cacgagatcatcggcatatccaaggcctatgtcacgcgggtcggcagcggtccgttcccc
actgaactccttgacgccgatggcgagaaactgcggcaggttggccacgaattcggcgca
accaccgggcggccgcgccgctgcggctggttcgacgccatggtggtccgctacgcggta
cgggtcaatggcctcaccggcgtggcactgacaaagctcgatgtcctgaacgacttcgag
accatcaaagtctgcaccggctacaccttcgaaggcaaacccttggccgacctccccgcc
aacctcgccgtgttcgaaaagtgcgaaccggtctacgaggagctgccgggctggatgagc
gacatcagcggtgcgcgcaccttcgaagagctgcccgagaaggcgaaaagctacgtgaag
cgcctcgagcaactgatcggctgccccatcgtcctcgtctccatcgggccgcgccgggac
cagaccataatcatcagcaacccgtttcaggataaagtgtaa

DBGET integrated database retrieval system