KEGG   Gordonia terrae: BCM27_02840Help
Entry
BCM27_02840       CDS       T04440                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
gta  Gordonia terrae
Pathway
gta00361  Chlorocyclohexane and chlorobenzene degradation
gta00625  Chloroalkane and chloroalkene degradation
gta01100  Metabolic pathways
gta01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCM27_02840
   00361 Chlorocyclohexane and chlorobenzene degradation
    BCM27_02840
Enzymes [BR:gta01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BCM27_02840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ANY21882
UniProt: A0A4U9Y956
Position
complement(613695..614420)
Genome map
AA seq 241 aa AA seqDB search
MSADLHPRVKVLAFDTFGTVTDWFTGISDSVRETVPGVDAASFAKDWRRRYSPILARVES
GELPWRRLDDLQTETLQEVAALHDVSLDGAQARSLVRAWRTIPGWPDAADGLRRLKRDHI
ICALSNGTVALLTDMARHNGFPWDVVGGSDLWRHYKPARETYCGLADLLEVEPAEVMMVA
THQSDLDAARSFGLRTAFIERPDEWGGDEKDDSGSPDNDYHATDLLDLARQLSRAESVAP
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctgaccttcatccccgtgtgaaggtcctcgctttcgacaccttcgggacggtc
accgactggttcaccggcatctccgactccgtccgcgagaccgtcccgggtgtcgacgcc
gcgtcgttcgccaaggactggcggcgccggtattcgccgatcctggctcgcgtcgaatcc
ggcgagctgccgtggcgccgcctcgacgatctgcagaccgagaccctgcaggaggtcgcc
gcgctgcacgacgtgtcgctcgacggcgcgcaggcccgctctcttgtccgtgcctggcgg
acgatccccggctggccggacgccgccgacggcctccggcgcctcaaacgcgatcacatc
atctgcgcgctgagcaacgggaccgtcgccctgctcaccgacatggcccggcacaacgga
ttcccctgggacgtcgtcggtggttccgacctctggcggcactacaagccggcgcgcgag
acctattgcgggctggccgatctcctcgaggtcgaaccagccgaggtgatgatggtggca
acccaccagagcgatctcgacgccgcccggtccttcggactgcggacggcgttcatcgag
cggcccgacgagtggggcggggacgagaaagacgactccggttcgccggacaacgactac
cacgccacggatctgctcgacctcgcgcgtcagctgagccgcgccgagagcgtcgcgccc
ggatga

DBGET integrated database retrieval system