KEGG   Gordonia terrae: BCM27_03090Help
Entry
BCM27_03090       CDS       T04440                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
gta  Gordonia terrae
Pathway
gta00790  Folate biosynthesis
gta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCM27_03090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gta04147]
    BCM27_03090
Enzymes [BR:gta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BCM27_03090
Exosome [BR:gta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCM27_03090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_6 Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ANY21922
Position
664999..665670
Genome map
AA seq 223 aa AA seqDB search
MTGSTRSPLTTAQAAEMVADPWRVIADRLAAAYNTGSMVRGGEFVAKIIDAAEEANHHPD
IDLRYGTVHLVLTTHSAHQLTEADVALANRITGIAADLGLEPASAPVTQFNLAIDALDIP
AIRPFWKAVLGYGDATEREPVDLVDPGGRLPSVWFQQMDEPRPQRNRMHVDLWIPTDELH
ERLQAAITAGGQLLTDEYAPAFWVLADAEGNEVCLCTWQDQNY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctcaacccgctcaccgctcaccaccgcccaggctgccgagatggtggccgat
ccctggcgcgtcatcgccgacaggctggccgccgcctacaacaccggctcgatggtgcgc
ggcggtgagttcgtcgcgaagatcatcgacgccgccgaggaagcgaaccaccaccccgac
atcgatctgcgttacgggacagtgcatctcgtgctcaccacgcacagtgcgcatcagctc
accgaagccgatgtcgcactggcgaaccggatcaccggcatcgccgccgacctcggcctc
gaaccggcctccgcacccgtcacgcagttcaacctggccatcgacgcccttgacatcccg
gccatccggccgttttggaaagcagtgctgggctacggcgacgccaccgagcgcgaaccc
gtagacctcgtcgacccgggaggccgactgcccagcgtttggttccagcagatggacgag
ccgcgcccgcaacgcaaccgcatgcacgtcgacctgtggattccgaccgacgaactccac
gagcgtctgcaagcagcgatcaccgccggcggacaactgctcaccgacgagtacgccccg
gccttctgggtgctcgccgacgcggaaggcaacgaggtgtgtctgtgcacctggcaggat
cagaactattga

DBGET integrated database retrieval system