KEGG   Gordonia terrae: BCM27_05630Help
Entry
BCM27_05630       CDS       T04440                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
gta  Gordonia terrae
Pathway
gta00071  Fatty acid degradation
gta00410  beta-Alanine metabolism
gta00592  alpha-Linolenic acid metabolism
gta00640  Propanoate metabolism
gta01040  Biosynthesis of unsaturated fatty acids
gta01100  Metabolic pathways
gta01110  Biosynthesis of secondary metabolites
gta01200  Carbon metabolism
gta01212  Fatty acid metabolism
Module
gta_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BCM27_05630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCM27_05630
   00592 alpha-Linolenic acid metabolism
    BCM27_05630
   01040 Biosynthesis of unsaturated fatty acids
    BCM27_05630
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCM27_05630
Enzymes [BR:gta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     BCM27_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_1
Motif
Other DBs
NCBI-ProteinID: ANY22364
UniProt: A0A4U9Z0T6
Position
complement(1224040..1226133)
Genome map
AA seq 697 aa AA seqDB search
MATPTAPSEKTPAEKSSDEKTPSTTSPTPIATEPTVDDPVTPASVSADDELSADERALLV
DNLRFVLDGRWRTTRETVRANSNRADLLPDPARTLDEARAHTLEVMRDLASQGFAAAGFA
EDHGGSGDIGVSITAIEMLGYADLSLMVKAGVQWGLFGGAVENLGTARHHEKYVPGIIDL
SVLGCFAMTETGHGSNVQAIETTATYDRDAREFVINSPTPSSRKDYIGGAAAHAHYAAVF
AQLVTGAPDEEAEGRGVHCFVVPIRDEDGNDLPGVTTSDCGYKGGLAGVDNGRIMFDNVR
IPAENLLNRYADVAEDGSYSSPIENTNRRFFTMLGTLIRGRVSVAATAGAAGRKALALST
RYGLIRKQFEAPEGTDEITVMDYLGHQRKLLPLIAKSYAIGFAQNEIVDELHEVQSVAPD
DSDAGRQRQLEGQAAGLKAYATWHASHAINVSREACGGAGYLDENQLSIMRGDIDVFTTF
EGDNTIMTQLIAKELLSAYSEDVQGLSAGGWVRFIAGMARDVVAEKTAVRQVVQTLLDGS
DEDTEKSALTDRSTQIRLFRNREDHLVRTCAQRLRRALDDDNDAFEVFNNAQDHLLKVGH
AHIERVVLEAFVEAIENCDSRSAADLLGKVCDLFVYSALEDDLSWFLMHRHISVERAKAI
RRGVNELCQELRPHARSLVDAFGVPEELLRAPMLQNG
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccccaccgccccctccgagaagactccggccgagaagagctcggacgagaag
accccgtcgacgacgagcccgactcccatcgccaccgaaccgacggtcgacgacccggtg
acgccggcctctgtctccgccgacgacgaactgtccgcggacgagcgggccctgctggtc
gacaatctgcggttcgtcctcgacggtcgctggcggacgacgagggagacggtgcgggcg
aactcgaatcgcgccgacctgctgcccgatccggctcggacactcgacgaggcccgcgcc
cacaccctcgaggtgatgcgcgatctggcctcccagggtttcgcagccgccggtttcgcc
gaagaccacggcggcagcggtgacatcggcgtgtcgatcaccgccatcgagatgctcggc
tatgccgacctgtccctcatggtgaaggcgggtgtgcagtggggcctcttcggcggcgcc
gtcgagaacctcggcaccgcacggcatcacgagaagtacgtgcccgggatcatcgacctg
agcgtcctcggttgcttcgcgatgaccgagaccgggcacggctcgaacgtccaggccatc
gagaccacggcgacctacgaccgcgatgcccgcgagttcgtgatcaactccccgaccccg
tcgtcccgcaaggactacatcggcggcgccgccgcgcacgcccactacgccgcggtgttc
gcacagctcgtcaccggcgcacccgacgaggaggccgaaggccgtggcgtgcactgtttc
gtggtgccgatccgcgacgaggacggcaacgacctgcccggtgtcaccaccagcgactgc
ggatacaagggcggactcgccggcgtcgacaacggccggatcatgttcgacaacgtccgc
atccccgcggagaacctgctcaaccggtacgccgacgtggccgaggacggcagctacagc
tcgccgatcgagaacaccaaccgtcgcttcttcaccatgctcggcacgttgatccgtggt
cgggtgagtgtcgcggcgaccgcaggcgccgccggccgtaaggcgctggcgctgtccacc
cgctacggactgatccgcaagcagttcgaggcgcccgagggcaccgacgagatcaccgtg
atggattacctcggacaccagcgaaagctgttgcccctcatcgccaagtcgtacgcgatc
ggcttcgcgcagaacgagatcgtcgacgagttgcacgaggtccagtcggtcgcacccgac
gactccgacgccggtcgtcagcgccagctcgagggccaggccgccggcctgaaggcctac
gcgacctggcacgcctcccacgccatcaatgtcagccgcgaagcatgcggcggcgcaggc
tatctcgatgagaaccagctgtcgatcatgcgcggcgacatcgacgtgttcaccaccttc
gagggcgacaacacgatcatgacgcagctgatcgcgaaagaactgctgtcggcgtactcc
gaagacgtgcaaggactctcggccggcggctgggtgcggttcatcgccgggatggcacgt
gatgtggtggccgagaagaccgcggtccggcaggtcgtgcagaccctgctcgacggctcc
gacgaggacaccgagaagtccgcgctcaccgaccgcagcacgcagatccgactgttccgc
aatcgcgaggaccacctggtccgcacgtgcgcgcaacgactgcgccgcgccctcgacgac
gacaacgacgccttcgaggtgttcaacaacgcgcaggaccacctgctgaaggtgggccac
gcccacatcgagcgtgttgtgctcgaggccttcgtcgaggcgatcgagaactgcgattct
cgttccgcggcagatcttctgggcaaggtgtgcgatctgttcgtctattcggcgctggag
gacgacctgtcctggttcctgatgcaccggcacatctcggtggagcgcgcgaaggccatc
cggcgcggggtgaacgaactctgccaggagctgcgcccgcacgctcggtcgctcgtcgac
gcattcggtgtccccgaagaactgctgcgcgcacccatgttgcagaacggctga

DBGET integrated database retrieval system