KEGG   Gordonia terrae: BCM27_09920Help
Entry
BCM27_09920       CDS       T04440                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
gta  Gordonia terrae
Pathway
gta00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCM27_09920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gta01007]
    BCM27_09920
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gta03016]
    BCM27_09920
   03029 Mitochondrial biogenesis [BR:gta03029]
    BCM27_09920
Enzymes [BR:gta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BCM27_09920
Amino acid related enzymes [BR:gta01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BCM27_09920
Transfer RNA biogenesis [BR:gta03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCM27_09920
 Prokaryotic type
   Other AARSs
    BCM27_09920
Mitochondrial biogenesis [BR:gta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCM27_09920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1g tRNA-synt_1 HIRAN
Motif
Other DBs
NCBI-ProteinID: ANY23070
UniProt: A0A4V0A0U5
Position
2188864..2190516
Genome map
AA seq 550 aa AA seqDB search
MTPADLAALLRAATLTVVRDRGLDENLVPDSIVVERPRHADHGDYSTNVALQMGKRLGVN
PRELAGWLAEAFAAAEGIAKTDVAGPGFVNVWLGAAAQNTVVAAVLARGADYGRGNELAG
SVINLEFVSANPTGPIHLGGTRWAAVGDALGRVLAARGGAVTREYYFNDHGAQIDRFARS
LEAAALGDPTPQDGYAGDYIADIAAQVVQAAPDVLSQPEADRLETFRSVGVDLMFAHIKQ
SLHDFGTDFDVFTHEDKMFATGLVDECIGELKANGNLYEKDGAWWLRSTEFGDDKDRVVL
KSDGNAAYIAGDIAYYRDKRNRGFNLCIYMLGADHHGYISRLKAAAAALGDDPATVEVLI
GQMVNLVREGKPVRMSKRAGTVITLDDLVDAVGVDGARYSLIRSSVDVNIDIDLDLLTKQ
SNDNPVYYVQYAHARMSALARNAADLGVVSSLEHLDLLDDPAEGELIRTIGDFDDVVATA
ATLREPHRVCRYLEVLAGTYHRFYAKCRVLPQGDEKPADIHRARLALCEATRQVLANGLG
LVGVTAPEQM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgactcccgccgacctggccgcgctgctgcgcgccgcgaccctgaccgtggtccgcgac
cgcggactggacgagaacctggtgcccgactccatcgtcgtcgagcgcccccgtcacgct
gaccacggcgattactccaccaatgtcgccctgcagatgggcaagcgactcggcgtgaac
ccgcgggaactcgcgggttggctggcggaggccttcgccgccgcggagggcatcgcgaag
accgacgtcgcgggtccgggattcgtcaacgtctggctcggcgccgccgcgcagaacacc
gtcgtcgccgccgtgctcgcgcggggagcggactacgggcgcgggaacgaactcgccggg
tcggtcatcaacctcgaattcgtctcggcgaacccgaccggccccatccatctcggcggt
acgcgctgggcggccgtcggcgacgcgctcggacgcgtcctggccgcccgcggtggagcg
gtcacgcgcgagtactacttcaacgatcacggcgcccagatcgaccggttcgcccggtcg
ctggaggccgcggcactgggcgacccgaccccgcaggacggctacgcgggcgattacatc
gccgacatcgccgcgcaggtcgtccaggcggcccccgacgtgctgtcgcagcccgaggcc
gaccgtctggagacgttccgttcggtcggcgtggacctgatgttcgcccacatcaagcag
agcctgcacgacttcggtaccgacttcgacgtcttcacccacgaggacaagatgttcgcc
accggcctggtcgacgagtgcatcggcgagctgaaggccaacggcaacctctacgagaag
gacggcgcgtggtggctgcggtccaccgagttcggtgacgacaaggaccgcgtcgtcctc
aagagcgacggcaacgcggcctacatcgccggcgacatcgcctactaccgggacaagcgc
aaccgcggattcaacctgtgcatctacatgctcggggccgaccaccacggctacatcagc
cggctcaaggcggccgccgcggcgctgggagacgacccggccaccgtcgaggtgctgatc
ggccagatggtcaatctcgtccgcgagggcaagcccgtgcgcatgagcaagcgtgcgggc
accgtcatcaccctcgacgatctcgtcgatgcggtgggggtcgacggtgcgcgctattcc
ctcatccgctcgtccgtcgacgtcaacatcgacatcgacctcgacctgctgaccaagcag
tccaacgacaacccggtgtactacgtgcagtacgcccacgcgcggatgtcggcgctggcc
cgcaacgcggccgacctgggcgtcgtgtcctcgctggaacatctggaccttctcgacgat
cccgccgagggcgaactgatccggaccatcggcgatttcgacgacgtcgtcgcgacggcg
gccaccctgcgcgagccacaccgggtgtgtcgctacctcgaggtactcgccggcacctat
caccgcttctacgcgaagtgccgcgtcctgccgcagggtgacgagaagccggccgacatc
caccgcgcccgactcgccctgtgtgaggccacccgtcaggtcctggccaacggcctcggc
ctggtcggcgtcaccgcaccggagcagatgtga

DBGET integrated database retrieval system