KEGG   Gordonia terrae: BCM27_16265Help
Entry
BCM27_16265       CDS       T04440                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
gta  Gordonia terrae
Pathway
gta00903  Limonene and pinene degradation
gta00930  Caprolactam degradation
gta01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCM27_16265
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BCM27_16265
Enzymes [BR:gta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BCM27_16265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_1 Peptidase_S9 COesterase
Motif
Other DBs
NCBI-ProteinID: ANY24141
Position
complement(3629253..3630149)
Genome map
AA seq 298 aa AA seqDB search
MARTPALERVEKMYLEGFPDPATATVDDLREAYDRLFLQFALPEGVEPSEDEVGGVPVLR
VAAEGAAEDKVLVWFHGGGNIMGSARGFQELGHNLSRASGVTAILADFRRAPEHPFPAAS
DDTVAVISALVERHGAHNVAVGGDSAGGGLVLGALVALRDKGENLPAAAVFISPLLDLTA
SGDSIDEFDGKDIAVSRGSIGNVSAAYLQGHDPADPQASPLFAELKDLPPALFMVGSGEV
LRDDSRRAAAKIVEAGGSASVSLYDDMVHVWPLFSSILPEGIQAADEAGAFLRKNLSV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggccaggacacctgcgctcgaacgcgttgagaagatgtacctcgagggcttccccgac
cccgcgacagcgacggtcgacgacctacgcgaggcctacgatcgactgttcctgcaattc
gcactgcccgagggtgtcgaaccgtccgaggacgaggtcggcggagttcccgtgctgcgc
gtcgcggcggagggggcggcggaggacaaggtcctcgtctggttccatggtggcggcaac
atcatgggcagcgcccgcggcttccaggagctcggacacaacctgtcgcgggcctcgggg
gtgacggcgatactcgccgacttccggcgggcgcccgagcatccgttcccggcagcctcg
gacgacacggttgcggtgatcagcgcgctcgtcgaacgtcatggtgcgcacaatgtcgcg
gtcggcggcgattcggccggcggcgggctggtgctcggcgcgctggtcgccctccgtgac
aagggtgaaaacctgcccgccgctgcggtgttcatctcgccgctgctcgacctgacagca
agcggcgacagtatcgacgaattcgacggcaaggacatcgctgtgtcccggggttcgatc
ggcaatgtgagcgcggcgtatctgcagggtcacgatcccgccgacccgcaggcatctccg
ctgttcgcggagctgaaggacctgcccccggccttgttcatggtcggatcaggtgaggtt
ctgcgcgatgattcgcgccgagcggcggcaaagatcgtcgaagccggtggatcggcgtcg
gtgtcgctgtacgacgacatggttcacgtgtggcccctcttctcgtcgattctgcccgaa
ggaatccaggcagctgacgaagccggcgcgttccttcggaagaacctctcggtgtga

DBGET integrated database retrieval system