KEGG   Gordonia terrae: BCM27_16995Help
Entry
BCM27_16995       CDS       T04440                                 

Definition
(GenBank) methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
gta  Gordonia terrae
Brite
KEGG Orthology (KO) [BR:gta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gta03009]
    BCM27_16995
Enzymes [BR:gta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BCM27_16995
Ribosome biogenesis [BR:gta03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BCM27_16995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Trm112p
Motif
Other DBs
NCBI-ProteinID: ANY26161
Position
complement(3786310..3787206)
Genome map
AA seq 298 aa AA seqDB search
MVEILRCPVCTGPLSVDGTALRCPDAHSFDIARQGYVSLLDGRSGSLRADTAAMVAARAR
VHDAGFFAPVVDSVARLTAEFASGVPRPVILDAGAGGGHYLRAAVAASGTSDGVVESPVA
GIGIDLSKYCARAIARGPHALAAVVGDVWRELPVVDDAVSVVLSVFAPRNATEFARVLTP
DGALIIVSPGPDHLSELIEPMEMLRVDAAKSARLHAALDDGFELVDEAPLRYTADVGAGI
IGDLVAMGPSAFHSEEADIRSRADDFAGDGRVPVTVSVVVTTCRPTRGRRPDQRRTDS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atcgtcgagatccttcgatgcccggtgtgcaccgggccgctctcggtcgacggcactgcc
ctgcgttgtcccgacgctcattcattcgacatcgcccgacagggctacgtctcactgctc
gacggtcggtcggggtcgttgcgcgccgacaccgcggccatggtggccgcccgggcgcgt
gtgcacgacgccggtttcttcgccccggtggtcgattccgtcgcccgactcaccgccgag
ttcgcgagcggagtcccgcggcccgtgatcctcgacgcgggcgccggtggcggacactat
cttcgcgccgcggtcgcggcgagcggaacgtcggacggtgtcgtcgaatccccggtcgcc
ggaatcggcatcgacctgtccaaatactgcgcgcgcgccatcgcccgggggccgcacgcg
ctcgccgcagtcgtcggcgacgtctggcgcgagctaccggtcgtcgatgacgctgtctcg
gtggtgctctcggtgttcgcgccccggaacgcgaccgagttcgcccgggtcctgacaccc
gatggcgcactgatcatcgtgagcccggggcccgaccatctctccgagctcatcgagccg
atggagatgctccgggtcgacgccgcgaaatccgcacggctccatgcagcgctcgacgac
ggtttcgagctggtcgacgaggctccactgcggtacaccgcggacgtcggcgccgggatc
atcggcgatctggtcgcgatgggaccctcggcatttcattccgaggaggccgacatccgc
tctcgtgccgacgacttcgccggggacggccgcgtaccggtgacggtgtcggtcgtggtc
acgacgtgccggcccacccgcggacggcgcccagatcagcgccggacggactcgtag

DBGET integrated database retrieval system