KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_14320Help
Entry
GTCCBUS3UF5_14320 CDS       T01676                                 

Definition
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte02020  Two-component system
gte02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gte00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GTCCBUS3UF5_14320
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GTCCBUS3UF5_14320
Enzymes [BR:gte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GTCCBUS3UF5_14320
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     GTCCBUS3UF5_14320
Two-component system [BR:gte02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GTCCBUS3UF5_14320
Bacterial motility proteins [BR:gte02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GTCCBUS3UF5_14320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg TAL_effector Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: AEV18745
UniProt: G8N1V0
Position
1321925..1322974
Genome map
AA seq 349 aa AA seqDB search
MKTIKVLVVDDSAFMRKWISDFLSEHPRLEVIGTARNGREALEKIAALRPDVVTLDVEMP
VMNGLETLQRIMRDHPVPVVMVLSTTTEGAENTIAAMQYGAVDFVAKPSGPISLDLYKVK
DELIGKVLHASEANVAALTAPRRQRPSWRPSFKAAAQPQQAIVAIGTSTGGPRALETVLT
QLPPDLAAPVVAVQHMPKGFTTSLANRLDALAAITVKEAEDGEVLQNGTAYIAPGGVHLI
VREEGGALKARFDESPPRAGHRPAVDVLFESLAAIRRCRKIAVIMTGMGSDGTVGLKILK
ESGNTKAIAEARETAVVFGMPRAAIEAGVVDVIAPLDSIAAAIVQSIGE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcaaggtgcttgtcgtcgatgactcggcgtttatgcgcaaatggatcagt
gattttttgtccgagcatccgcgcctcgaagtcatcggaacagctcgcaacggccgggag
gcgctcgagaaaatcgctgccctaaggccggatgtcgtgacgcttgatgtggaaatgccg
gtcatgaacggactcgaaacgttgcagcgcatcatgcgggaccatcccgtgccggtcgtc
atggtgttaagcacgacgaccgaaggggcggaaaacacgatcgccgccatgcagtacggg
gcggtcgactttgtcgctaagccgtccggaccgatttcgctcgatttgtacaaagtgaaa
gacgagctgattggcaaagtgctgcacgcgagcgaagcgaacgtggctgccttgactgcc
ccgcgccgccaacgtccgtcttggcgcccatcgttcaaagcggcggcgcagccgcaacag
gccatcgtcgcgatcggcacttccaccggcggcccgcgcgcgctcgagacggtgctgacg
cagcttccgcccgatctagccgctccggtcgtcgctgtccagcatatgcccaaaggattt
acgacatcgctcgccaaccggcttgatgcgcttgccgcgatcacggtcaaggaggcggaa
gacggggaagtgctgcaaaatggcaccgcctatatcgcgccaggcggcgtccatctcatc
gttcgcgaagaaggcggcgcacttaaagcccgtttcgacgaatcgccgccgcgcgccggc
catcgtccggctgttgacgtgttgttcgagtcgctcgctgccattcgccgctgtcggaaa
atcgcggtgattatgaccggcatgggaagcgacggaacagtagggttgaaaatcctgaag
gaaagcgggaacacaaaagcgatcgcggaagcgcgcgagacagccgttgtctttgggatg
ccaagagcggcgatcgaggctggcgtcgttgatgtcatcgcaccgcttgacagcatcgcc
gctgccatcgtccaatcgatcggggagtga

DBGET integrated database retrieval system