KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_31850Help
Entry
GTCCBUS3UF5_31850 CDS       T01676                                 

Definition
(GenBank) Dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00300  Lysine biosynthesis
gte01100  Metabolic pathways
gte01120  Microbial metabolism in diverse environments
gte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GTCCBUS3UF5_31850
Enzymes [BR:gte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GTCCBUS3UF5_31850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEV20487
UniProt: G8N5L5
Position
complement(2934379..2935794)
Genome map
AA seq 471 aa AA seqDB search
MALNIDWMNEAKKRKDDLVRDVQALVRIPSVREDQQAQPGAPFGPKVAQALEHMLRRGRE
EGFRVKNVDGFAGHIEMGHGEKLVGVLGHIDVVPPGDGWTMDPFAAEVRDGRLYGRGAID
DKGPTVAAFYAMKIIRELGLPLGKRVRLIIGGDEESDWRCVEHYFRHEEMPDVGFAPDAD
FPIIYAEKGIIDADLSYRPPKSAEAEGLALASFQAGRRYNMVPDAAEAVVERAGRTEELL
GLYEQFCWERGVKGSMRQSEGAVVFQLEGVSAHGAEPERGKNAGVYLAQFLASLPLDGRS
RPFVQFVASAFFGDARGRRLGLAYRDEQSGDLTVNVGVLSYDRRHGGTIGLNIRYPVTAD
GDAIRRTLAGAAAEHGFALSRFSDTKPHYIDPSHELVRTLQRVYEEQTGEPARLLAIGGG
TYARALTAGVAFGALFPGRPDVAHQKDEYIEIDDLVKATAIYAQAIYELAK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaacatcgactggatgaacgaagcgaagaaacgaaaagacgatcttgtccgc
gacgtgcaagcgcttgtccgcattccgagcgtccgcgaggatcagcaggcgcaaccaggc
gcgccgtttgggcccaaggtggcccaggcgcttgagcatatgcttcgccgcggccgggag
gaagggtttcgcgtcaaaaatgtggacggatttgctgggcatatcgaaatggggcatggg
gagaaacttgtcggcgtgctcggccatatcgacgtcgtgccgcccggggacggctggacg
atggatccgtttgccgctgaggtgcgcgatggccgcctttacgggcgcggcgcgatcgat
gacaaagggccgaccgtcgcggcgttttacgcgatgaaaatcatccgtgaactcgggctg
ccgcttggcaagcgggtgcggctcatcatcgggggcgatgaggaaagcgactggcggtgt
gtggagcattattttcgccatgaggaaatgccggatgtcggatttgcgccggatgctgat
ttcccgatcatttatgctgaaaaaggaatcattgacgccgatttgtcgtaccgcccgcct
aaatcggcggaggcggaagggctcgcgcttgcctcattccaagccgggcgccgctacaat
atggtgccggatgcggccgaagcggtggtggaaagagcgggacggacggaggagctgctt
ggcctctatgaacagttttgctgggagcgcggcgtaaaggggagcatgaggcaaagcgaa
ggggccgtcgtctttcaattggaaggggtgtccgctcatggcgccgagccggagcgcggc
aaaaacgccggcgtctatttggctcagtttttggcgtcgcttccgctcgatggccgaagc
cggccgttcgttcagtttgtggcctccgccttttttggcgatgcccgcggccggcggctc
ggccttgcgtatcgggacgaacaaagcggcgacttgacggtcaacgtcggggtgctgtcg
tatgaccggcggcatggcggaacgattgggctgaacatccgctatccggtgacggccgac
ggtgacgcgatccgccggacgctcgccggcgctgcggctgaacatggattcgcgctcagc
cgtttcagcgatacgaagcctcattatatcgatccgagccacgagcttgtccgcacgctt
cagcgcgtctacgaagagcagacgggcgagccggcccggcttttggccatcggcggcggc
acatacgcccgcgccttgaccgccggggtggcgtttggcgcgttgtttccgggccgtccg
gatgtcgcccaccagaaagatgagtatatcgaaatcgacgatttggtgaaagcgacagcc
atttacgcgcaggcgatctacgagctggcgaaataa

DBGET integrated database retrieval system