KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_34430Help
Entry
GTCCBUS3UF5_34430 CDS       T01676                                 

Definition
(GenBank) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00340  Histidine metabolism
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01230  Biosynthesis of amino acids
Module
gte_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    GTCCBUS3UF5_34430
Enzymes [BR:gte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     GTCCBUS3UF5_34430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus IMPDH DHO_dh G3P_antiterm Cas_VVA1548
Motif
Other DBs
NCBI-ProteinID: AEV20744
UniProt: G8MX21
Position
complement(3162285..3163022)
Genome map
AA seq 245 aa AA seqDB search
MAAFTIYPAIDMRGGKCVRLLQGDYNKETVYGDSPVAMAEQFAAQGAEWIHMVDLDGAKE
GRRVNDRFVIEAARRLSVHVQVGGGIRTEEDIVHYLENGVARVILGSAAISDPPFVKKML
QKYGRRIVIGIDARDGFVATEGWLATSNVKAEELGRMLAEAGAETFIFTDIATDGTLSGP
NIAAAVRLAEATGKEVIASGGVSSLDDLRALCQYAGQGIGGAIVGKALYTNQFTLAEALK
AVNER
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtttacgatttatccggcgatcgatatgcgcggcggcaagtgcgtccgcctg
ctgcaaggcgattacaacaaagaaacggtgtacggcgattcgccggtcgcgatggccgag
caattcgccgctcaaggggcggagtggattcatatggtcgatttggacggagcgaaagaa
gggcgccgcgtcaacgaccggtttgtcattgaagcggcccgtcgtctttccgtccatgtg
caagtgggcggcggcatccggacggaagaggatatcgtgcattatttagaaaatggggtc
gcccgcgtcattttaggaagtgcggccatttccgacccgccgtttgtgaaaaagatgctc
caaaaatacggccgccgcatcgtgattggcattgacgcccgcgacggcttcgtggcgacg
gaagggtggcttgcgacgtcgaacgtcaaggcggaagagctcgggcggatgctcgctgag
gcgggggcggagacgtttattttcaccgatattgcgaccgatggcacgctgtcgggcccg
aacatcgccgccgcggtccggttggccgaggcgacgggaaaagaagtgatcgcttctggc
ggcgtcagctcgcttgacgatttgcgcgcgctctgccaatatgctggacaaggcatcggc
ggcgcgatcgtcggcaaggcgctttatacgaatcagtttacgctcgcggaagcgctcaag
gcggtgaacgagcgatga

DBGET integrated database retrieval system