KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_3690Help
Entry
GTCCBUS3UF5_3690  CDS       T01676                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00970  Aminoacyl-tRNA biosynthesis
gte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GTCCBUS3UF5_3690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gte03029]
    GTCCBUS3UF5_3690
Enzymes [BR:gte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GTCCBUS3UF5_3690
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GTCCBUS3UF5_3690
Mitochondrial biogenesis [BR:gte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GTCCBUS3UF5_3690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AEV17695
UniProt: G8N347
Position
348344..348634
Genome map
AA seq 96 aa AA seqDB search
MSRISIDQVKHVADLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMR
NVMREDIPEPGLPREEVLKNAPDQQDGQFRVPAILE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaatttccattgaccaagtgaaacatgtcgccgatttggcgcggttggcgatt
acggatgaagaggccgagatgtttacgaaacagctcgatgcgattattacgtttgctgag
cagctgaatgaattggatacggagaacgttccgccgacttcgcacgtgcttgatatgaga
aacgtgatgcgcgaggatattccagaaccggggctgccgcgcgaagaagtgttgaaaaac
gcgccagatcagcaagacggccagttccgtgtgccggccattttagagtaa

DBGET integrated database retrieval system