KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_38170Help
Entry
GTCCBUS3UF5_38170 CDS       T01676                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00071  Fatty acid degradation
gte00072  Synthesis and degradation of ketone bodies
gte00280  Valine, leucine and isoleucine degradation
gte00310  Lysine degradation
gte00362  Benzoate degradation
gte00380  Tryptophan metabolism
gte00620  Pyruvate metabolism
gte00630  Glyoxylate and dicarboxylate metabolism
gte00640  Propanoate metabolism
gte00650  Butanoate metabolism
gte00900  Terpenoid backbone biosynthesis
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01130  Biosynthesis of antibiotics
gte01200  Carbon metabolism
gte01212  Fatty acid metabolism
gte02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GTCCBUS3UF5_38170
   00630 Glyoxylate and dicarboxylate metabolism
    GTCCBUS3UF5_38170
   00640 Propanoate metabolism
    GTCCBUS3UF5_38170
   00650 Butanoate metabolism
    GTCCBUS3UF5_38170
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GTCCBUS3UF5_38170
   00072 Synthesis and degradation of ketone bodies
    GTCCBUS3UF5_38170
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GTCCBUS3UF5_38170
   00310 Lysine degradation
    GTCCBUS3UF5_38170
   00380 Tryptophan metabolism
    GTCCBUS3UF5_38170
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GTCCBUS3UF5_38170
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GTCCBUS3UF5_38170
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GTCCBUS3UF5_38170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gte04147]
    GTCCBUS3UF5_38170
Enzymes [BR:gte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GTCCBUS3UF5_38170
Exosome [BR:gte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTCCBUS3UF5_38170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2496 SpoVAD
Motif
Other DBs
NCBI-ProteinID: AEV21117
UniProt: G8N000
Position
complement(3504396..3505574)
Genome map
AA seq 392 aa AA seqDB search
MGKTVIVSGARTPFGKLGGSLQALSASELGGIAVKEALARADVSVEQVDHVILGTVLQGG
QGQLPSRQAMRHAGIPWHVRTETVNKVCASGMRAVTLADQLIRLGDADVVVAGGMESMSN
APYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGNTARELGITREAQDEWAY
RSHMRAIAAIEAGRLAEEIVPVTIPQRKGEPLVVEHDEAPRKDTSLEALAKLPPVFDPEG
TITAGNAPGVNDGAAALVLMSEERAAREGLEPLATVVAHTAIAVEAKDFPKTPGLVINEL
LRKTGKTVDDIALFEINEAFAAVALAAIQIAGLDPEKVNVNGGAVALGHPIGASGARIIL
TLIYELKRRGGGLGIAAICSGGGQGDAILVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaacagtgattgtcagcggggcgcgcaccccgttcggaaaactcggcggttct
ttgcaagcgctgtcagcgtcagaactcggcggcattgccgtgaaagaagcgcttgcccgc
gcggatgtgagcgtggaacaagtcgatcatgtcattttaggcaccgtcttgcaaggcgga
caaggacagctcccatcacggcaggcgatgcgccatgccggcattccgtggcatgttcgc
accgagacggtcaataaagtatgcgcatcgggcatgcgcgccgtgacgctcgcggatcag
ctcatccgcttaggcgacgccgatgtcgttgtcgcgggcgggatggaatcgatgagcaac
gccccgtacgtgctgccgaaagcgcgctgggggttgcgaatgggcgacagcacggtgaag
gatttaatggtgtatgatggcttgacatgcagttttaccggcgtccatatgggcgtttat
ggcgggaatacagcgcgtgaacttggcattacacgcgaggcgcaggatgagtgggcgtac
cgcagccatatgcgagccattgccgccatcgaagccggtcggctcgcggaagagatcgtt
ccggtgacgattccgcagcgcaaaggagagccgcttgtcgtcgaacacgacgaggcgccg
cgcaaagacacgtcgcttgaagcgttggcgaaactgccgccggtgtttgacccggaagga
acgatcactgccggcaacgccccgggcgtcaacgacggcgccgcggcgctcgtcttgatg
agcgaggagcgcgccgcccgcgaggggcttgagccgctcgcgactgttgtcgcccacacc
gccatcgccgttgaggcgaaagatttcccaaaaacgccgggacttgtcatcaacgagctg
ctccgcaaaacgggaaaaacggtcgacgacattgccttgttcgaaataaacgaagcgttt
gccgctgttgctcttgctgcgatccaaatcgccggccttgacccggaaaaagtgaacgtc
aacggcggcgctgtcgccctcggccacccgatcggcgcgagcggcgcacgcatcatcctc
acgctcatttatgagctgaaacgccgcggcggcggcctcggcatcgccgccatctgcagc
ggcggcggccaaggcgacgccatcttggtcgaggtataa

DBGET integrated database retrieval system