KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0062Help
Entry
Geoth_0062        CDS       T01531                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00900  Terpenoid backbone biosynthesis
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Geoth_0062
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Geoth_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEH46122
Position
51561..52430
Genome map
AA seq 289 aa AA seqDB search
MKVLVKAPAKINLSLDVLHKRPDGYHEVKMVMTTIDLADRIELIPRTDDVIQIISQNRFV
PDDHRNLAYQAAKVLKDTFGIKQGVAISLTKNIPVAAGLAGGSSDAAATLRGLNKLWRLG
LTLDELAELGAQIGSDVPFCVYGGTAVATGRGEKIMPISSPPPCWVILAKPSIGVSTAEV
YRNLKVGEIQHPDVDGMVEAIERQDYAAICQLVGNVLEEVTLKMHPEVAHIKEQMKRFGA
DAVLMSGSGPTVFGLVQHDSRLQRIYNGLRGFCDQVFAVRILGEQNSLD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtattagtcaaggcaccggctaaaatcaatttatcgttggacgtattgcataaa
cggcctgacggatatcatgaagtaaagatggtaatgacaacgattgatctggcggatcgc
atcgaactaattccgcggaccgatgatgtgatacaaattatttcgcaaaaccgcttcgtt
ccggatgaccaccgcaatctggcgtaccaggctgcaaaagtattgaaagatacatttggt
atcaaacaaggggtggcgatttcccttacaaaaaatattccagtagcggcagggctggcc
gggggaagcagcgatgctgcagcgacgctccgcggcttaaacaagctttggcgtttaggg
cttacacttgatgaattggcggagctaggtgcgcaaatcggttctgacgtcccgttttgc
gtttatggcggaactgcggttgcaacagggcgcggcgaaaaaattatgccgatttcttcc
ccgccgccatgctgggttattttagcaaagccatcgatcggcgtttcgactgccgaagta
taccggaatttaaaggttggcgagattcagcacccggatgtggatgggatggtggaggcg
attgaacgccaagattatgcggctatttgccaattagtcggaaacgtattagaagaagtg
acattgaaaatgcatccggaagtggcgcacattaaagagcaaatgaagcggtttggcgcg
gatgcggtattgatgagcggcagcgggccgacggtgtttggactcgttcagcatgattcc
aggctgcaacgaatttataatggactgcgcgggttttgcgatcaagtgttcgctgtccgg
atattaggtgaacaaaattcacttgattaa

DBGET integrated database retrieval system