KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0444Help
Entry
Geoth_0444        CDS       T01531                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00010  Glycolysis / Gluconeogenesis
gth00051  Fructose and mannose metabolism
gth00562  Inositol phosphate metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
gth01230  Biosynthesis of amino acids
Module
gth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gth_M00002  Glycolysis, core module involving three-carbon compounds
gth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_0444
   00051 Fructose and mannose metabolism
    Geoth_0444
   00562 Inositol phosphate metabolism
    Geoth_0444
Enzymes [BR:gth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Geoth_0444
Exosome [BR:gth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Geoth_0444
  Exosomal proteins of bladder cancer cells
   Geoth_0444
  Exosomal proteins of melanoma cells
   Geoth_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEH46481
Position
465375..466136
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLPEAVSFVEEVKRLVPPAEQVDSVICAPFLFLDRLVQNVQGSDLK
IGAQNMHFEDKGAFTGEISPVALKDIGVAYVIIGHSERREMFAETDETVNKKVHAAFKHG
LIPIVCCGETLEQRESGKTNDIVGAQVEKALAGLTAEQAKQVVIAYEPIWAIGTGKSSTA
EDANEVCGHIRSVIAKIFSPEVAEAVRIQYGGSVKPENIREFLAQEHIDGALVGGASLDP
KSFLQLVEAGQHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgaattatcgcaggaaactggaaaatgcataaaacattgccggaggcagta
agcttcgtggaagaagttaaacggcttgtgccgccggcagaacaagttgactctgtcatt
tgcgcccctttcttgtttttagaccgtcttgtccaaaatgtacaaggctctgatttaaaa
atcggtgcgcaaaacatgcattttgaagacaaaggggcgtttactggcgaaatcagcccg
gttgcgctgaaagatatcggcgtggcgtatgtcattatcggccactccgagcgccgcgaa
atgtttgcggagacggatgaaaccgtcaataaaaaagtgcatgctgcctttaagcatggg
ctgattccgatcgtctgctgcggcgaaacgctggaacagcgggaaagcggcaaaacaaat
gacatcgtcggcgcgcaagttgaaaaagcgcttgccggtttaactgcggagcaagcgaaa
caagtggtgatcgcctatgagccgatttgggcgattggcactggcaaatcatcgacggca
gaagatgccaacgaagtgtgcggccatattcgttcggtcatcgccaaaatcttttctccg
gaagtggctgaagccgtgcgcattcagtatggcggcagcgtcaaaccggaaaacatccgc
gaatttttagcgcaagaacatattgatggcgcccttgtcggcggcgcaagcctcgatccg
aaatcatttttacaattagtggaggctggacagcatgagtaa

DBGET integrated database retrieval system