KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1304Help
Entry
Geoth_1304        CDS       T01531                                 

Definition
(GenBank) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00650  Butanoate metabolism
gth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Geoth_1304
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     Geoth_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB RVT_3
Motif
Other DBs
NCBI-ProteinID: AEH47296
Position
1246426..1247325
Genome map
AA seq 299 aa AA seqDB search
MKLQSLIDRTTKSQNMTVAVAAAEDEEVIDAVAMALDRHFGKFVLYGDREQILQLLKQKN
YANSDNIQIVHANSAVQAAELAVRAVHSNEAGVLMKGNVPTAALLKAVLNKEYGLRIGKV
LSHVAVFEIPGYDRLIIVTDAAMNVSPDLEQKAQIIANAVAVAHAIGIETPKVAPLAAVE
IVNPSMPATVDAAALAMMQKRGQIKGCVIDGPLALDNAVSPKAAKHKRIDSEVAGKADIL
LVPDIEAGNMLYKSLVYFANAKVGAIIAGAKAPIVLTSRADSAESKLYSLALAVCSASK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcaatcgttgatcgatcgcacaacgaaatcccaaaatatgacggtagctgtt
gcggcagcggaggatgaagaagtcatcgatgcggtggcaatggcgcttgatcgccatttc
gggaaatttgtgttgtatggagatagggaacaaattttgcaactgttaaagcaaaaaaat
tatgcaaattcggacaacatacaaatcgtccacgccaattctgccgtacaagcggctgag
cttgcggtcagagcggttcattcaaatgaagcgggcgtgctgatgaaaggaaatgtcccg
accgctgcgcttttaaaagcggtgttaaacaaagaatatggtttgcgcatagggaaagtg
ctttcccatgtcgcggtatttgaaatccccggctacgaccggctcatcattgtgacagat
gccgcgatgaacgtttcaccagatttagagcaaaaagcgcaaattattgcgaatgcggtt
gcggtggcccatgcgattggcattgaaacgccaaaagtggcaccgcttgcggcggtggaa
atcgtgaacccatccatgccggcaactgtcgatgccgcggcattggcgatgatgcaaaag
cgcgggcaaataaagggatgtgttattgacggcccgctcgcgcttgataacgctgtttcg
cccaaggcagccaaacataagcggattgatagcgaagtcgcaggaaaagcagatattttg
ctcgttccggacattgaagcggggaacatgctgtataaatcgctcgtttattttgcaaac
gcaaaagtcggtgcaatcatcgctggggcaaaagcgccgattgtccttacgtcgcgcgcc
gattccgcagaaagcaagctttactcattagcccttgctgtttgttccgcatcgaaataa

DBGET integrated database retrieval system