KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1581Help
Entry
Geoth_1581        CDS       T01531                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00071  Fatty acid degradation
gth00280  Valine, leucine and isoleucine degradation
gth00281  Geraniol degradation
gth00310  Lysine degradation
gth00360  Phenylalanine metabolism
gth00362  Benzoate degradation
gth00380  Tryptophan metabolism
gth00410  beta-Alanine metabolism
gth00627  Aminobenzoate degradation
gth00640  Propanoate metabolism
gth00650  Butanoate metabolism
gth00903  Limonene and pinene degradation
gth00930  Caprolactam degradation
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01212  Fatty acid metabolism
Module
gth_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Geoth_1581
   00650 Butanoate metabolism
    Geoth_1581
  Lipid metabolism
   00071 Fatty acid degradation
    Geoth_1581
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Geoth_1581
   00310 Lysine degradation
    Geoth_1581
   00360 Phenylalanine metabolism
    Geoth_1581
   00380 Tryptophan metabolism
    Geoth_1581
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Geoth_1581
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Geoth_1581
   00281 Geraniol degradation
    Geoth_1581
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geoth_1581
   00627 Aminobenzoate degradation
    Geoth_1581
   00930 Caprolactam degradation
    Geoth_1581
Enzymes [BR:gth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Geoth_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEH47559
Position
1509567..1510343
Genome map
AA seq 258 aa AA seqDB search
MTEFAHIRTHVDENVAVIELHRPDVLNALNRKMVTEIVSAMEFYDRDEHVRVIVLTGSGR
AFAAGADIDEMANDDSITLELLNQFAEWDRLALIKKPTIAAVHGFALGGGFELALSCDLL
FAADTAEFGFPEVNIGVMPGAGGTQRLTKLIGKTKALEWLWTGERMSAKEAHELGIVNRV
IAPELLDEETMRFAKKLAKQPPLSVRLIKEAVNKAVDYSLYEGMQFERKNFYLLFSSEDQ
KEGMAAFIEKRKPRFQGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtttgcgcacattcgcacacatgttgatgagaatgttgctgtgattgaactg
catcgcccagacgtgttaaacgccttgaataggaaaatggtaacggaaatcgtcagcgcg
atggaattttacgaccgcgatgaacatgtgcgcgtcatcgtcttgacaggaagcggccgt
gcctttgcagcaggagcggatatcgacgaaatggcaaacgatgattccattacgctggaa
ttgcttaatcaatttgccgaatgggatcgccttgcacttattaaaaagcctacgattgcc
gccgtacacggttttgcattaggcggaggattcgaactcgcgcttagctgtgacctgttg
tttgcggccgatacagcggaattcggatttccggaagtgaatatcggtgtgatgccaggt
gcgggcggaacgcagcgccttactaaattaatcggcaaaacaaaagcgctcgagtggctt
tggacaggcgagcgtatgtcggcaaaagaagcgcatgaattagggattgtcaaccgtgtc
atcgcgccagagttattggatgaggaaacaatgcggtttgcgaaaaagctggcaaaacag
cctcctttatccgtccgcctaattaaagaagccgtgaataaggcagtagactattcgcta
tatgaaggcatgcagtttgagagaaaaaatttttatctccttttttcgtctgaggatcaa
aaagagggaatggcggcatttatcgaaaaacgaaagccgcgttttcaaggaagataa

DBGET integrated database retrieval system