KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_2345Help
Entry
Geoth_2345        CDS       T01531                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00071  Fatty acid degradation
gth00072  Synthesis and degradation of ketone bodies
gth00280  Valine, leucine and isoleucine degradation
gth00310  Lysine degradation
gth00362  Benzoate degradation
gth00380  Tryptophan metabolism
gth00620  Pyruvate metabolism
gth00630  Glyoxylate and dicarboxylate metabolism
gth00640  Propanoate metabolism
gth00650  Butanoate metabolism
gth00900  Terpenoid backbone biosynthesis
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
gth01212  Fatty acid metabolism
gth02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Geoth_2345
   00630 Glyoxylate and dicarboxylate metabolism
    Geoth_2345
   00640 Propanoate metabolism
    Geoth_2345
   00650 Butanoate metabolism
    Geoth_2345
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Geoth_2345
   00072 Synthesis and degradation of ketone bodies
    Geoth_2345
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Geoth_2345
   00310 Lysine degradation
    Geoth_2345
   00380 Tryptophan metabolism
    Geoth_2345
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Geoth_2345
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geoth_2345
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Geoth_2345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gth04147]
    Geoth_2345
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Geoth_2345
Exosome [BR:gth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Geoth_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AEH48270
Position
complement(2272894..2274150)
Genome map
AA seq 418 aa AA seqDB search
MELAISQRCNDVVKGGRIRIMTGVVIVDAVRTAIGKMGGTLKNVEVDYLAAKVIDEVLKR
NGIEGSEVDEVIMGQAKQSTDAPNMARVALLRAGLPVEVPGYTVHRQCGSGLQAINNAAQ
QIQCGLASIIVAGGAESMSTAPYYIRGARYGLEAGNGLLLDPNTESQPRSQPPEIYGKEL
TMGLTAEILAEKYQISRQEQDEFAFLSQSRAAYAISSGKFENEIVPFEVKLKKEMIHFKI
DEHPRLTPVEKLLTLPPVFKKDGTVTAGNSSGRNDGAAAVLVMSEIEAEKRGLKPKARIL
AQAVSGVSPEIMGIGPVPATRKALKMAGLQLEDIDLIELNEAFAAQSLAVIKELGLRLEK
VNVNGGAIALGHPVGATGAILMTKLIHEMERRGSRYGLVTLCIGGGQGITTIVENLRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaattagcgatttctcaaaggtgtaacgatgtggtaaagggagggagaataagaata
atgactggagttgtgattgtagatgctgtacgtacagcgatcggaaaaatgggcggcacg
ttaaaaaatgtagaagtggattatctagctgccaaggtgattgacgaagttctcaagaga
aacggaatagaaggctccgaagttgacgaagtgatcatggggcaagctaagcaaagtacc
gatgcgccaaatatggctcgtgttgcattgcttcgtgcggggctgccggtggaagttccc
gggtatacggttcaccgccaatgcggatcagggctacaggcgatcaataatgcggcacag
caaattcagtgcgggcttgcaagcatcattgtagcaggtggagcggaaagcatgagcaca
gcaccgtattatattcgaggcgcacggtacggccttgaagcaggcaacggcctcttgctg
gatccgaatacagaaagccaacctcgttctcaaccgcccgaaatctatggaaaggagttg
acgatgggactcacggcggaaattttagctgaaaaatatcaaatcagccggcaagagcag
gatgaatttgctttcctcagtcaaagccgggctgcctatgcgatttcgtctggtaaattt
gaaaatgaaattgtgccttttgaggtcaagctaaaaaaagaaatgatccattttaagatt
gatgagcatccgcgtctgactccggttgagaaattactcaccttgcctccagtctttaaa
aaagatgggacggtaactgccggaaactccagtggtcggaatgacggtgccgcagcggtt
ttagtcatgtcggagatagaggcggagaaacgaggtcttaagccgaaagcacggatcctc
gcacaggctgtgtctggagtgtcgccggaaattatgggaatcgggccggtgccagcgact
cgtaaggctttgaaaatggccggattgcagttagaagacattgacctgattgagttgaac
gaagcgtttgcagctcaatccctcgccgtcattaaagaattgggcctgagactggaaaag
gtaaacgtaaacggcggagctatcgcattagggcatcctgttggtgcgaccggcgctatc
ttgatgactaaactgatccatgaaatggagcggcggggttcgcgttacggactggtcacc
ctgtgcatcggaggcggtcagggaatcaccaccattgttgaaaacctgcggcgataa

DBGET integrated database retrieval system