KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_2478Help
Entry
Geoth_2478        CDS       T01531                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00010  Glycolysis / Gluconeogenesis
gth00020  Citrate cycle (TCA cycle)
gth00620  Pyruvate metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
Module
gth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_2478
   00020 Citrate cycle (TCA cycle)
    Geoth_2478
   00620 Pyruvate metabolism
    Geoth_2478
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Geoth_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C RnfC_N PTS_EIIA_1 HlyD_2
Motif
Other DBs
NCBI-ProteinID: AEH48383
Position
complement(2408757..2410022)
Genome map
AA seq 421 aa AA seqDB search
MAVEIFMPKLGMSMKEGTVVEWLKKKGDKVKKGESLVVISSDKIETDIEAPQDGVLLEIL
VEQDETAEVGKVIGYIGQEGEKLNIQSNETPQETAKQAMQEVAASVGTIEPNITSRHMLR
VSPAARKLAREAGIDVSNIKGTGPKGRITRADVEKAIQQKQASLQPVREKQTVAETNQIT
SAETNQITTEQQGVTVKPITGMRKVIATRMFASLQQTAQLTIHMKADVTELFELQGKLRE
ELQDEPDVKLTITDFIARATVLALSTHKQMNSLYQNGHIHTYDSVHLGIAVALANGLAVP
VIPYAEKLSLKEISKKIKELSARAREGKLSSEEMKGSTFTITSLGAYGVEFFTPVLNPPE
VGILGVGTAADTPVFIGDNIHKRKILPLSLTFDHQVIDGAPASQFLTAIKNYLEKPYKIL
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggaaatcttcatgccaaagttaggaatgagtatgaaagaaggaacggtagta
gagtggctcaagaaaaaaggagataaggtaaaaaaaggggaatcgctcgttgtcataagc
tccgataagattgagacagatatcgaagcaccgcaagacggggtgttattagagatcctt
gtcgagcaagatgaaacagcggaagtagggaaagtaattggctacattggccaagaaggg
gaaaaactaaacattcagtccaatgaaacgccacaagaaacagcaaaacaagcaatgcaa
gaagtggctgcatccgttggaaccattgaaccaaacataacgtcaagacatatgttgcgc
gtttctcctgccgcgagaaaactagcccgcgaggctgggatcgacgtaagcaatattaaa
ggcactggaccaaaagggcgaataacaagagccgatgtggaaaaggccattcaacaaaaa
caagcatccttgcaaccagtgcgcgagaagcaaacggtcgcggaaacaaatcagataacc
agcgcggaaacaaaccagatcacaacggaacaacaaggcgttacagtaaaaccgataacc
ggcatgcggaaagtaatcgcgacaagaatgtttgcaagcctgcagcaaacggcacagcta
acgattcatatgaaagcagatgtgacagagctgtttgaattacaaggaaaactaagggaa
gaactacaagacgagcctgatgtgaagcttacgattaccgattttatcgcccgggcaacg
gttttagcattaagcactcataaacaaatgaacagcctttatcaaaacgggcatatccat
acgtatgattccgtgcatttaggcattgctgtcgcgttggcgaacggtctggccgttccg
gtcatcccttatgccgagaaactttctttaaaagaaatttcgaaaaaaataaaggaattg
agcgcgcgggcaagggaaggaaaattaagcagcgaggaaatgaaaggctccacttttacg
ataacaagtctcggcgcatatggtgtggaattttttacgccagtgttaaatccgccggag
gtaggaatcctcggagtaggaacagccgcagatactccagtcttcataggagataacatc
cataaaagaaaaattttacctctaagtttaacatttgatcaccaagtgattgacggcgct
ccggccagccaatttcttactgccattaaaaattatttggaaaagccatataaaatatta
ttgtag

DBGET integrated database retrieval system