KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_2665Help
Entry
Geoth_2665        CDS       T01531                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00900  Terpenoid backbone biosynthesis
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Geoth_2665
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Geoth_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEH48553
Position
complement(2604242..2605396)
Genome map
AA seq 384 aa AA seqDB search
MTGLKYISILGASGSIGTQTLDIIRLHPDEFHLTAISIGKNVDMARAIIEEFAPQLVAVA
DADAYDKLRREYAGKVKIVYGEDGLTEAAVFPKTDIVVTAVVGSVGLVPTLRAIEAGKTI
ALANKETLVTAGHIVTAAAKKHGVALLPVDSEHSAIFQCLQGEKKKNVEKIILTASGGSF
RDKTREELKNVTVDEALRHPNWSMGAKITIDSATMMNKGLEVIEAHWLFGLPYEQIDVLL
HRESIIHSLVQFRDTSIIAQLGMPDMHVPIQYALTYPERLPLKNAKPLDLAEIGALHFQQ
VDFDRYRCLRLAYEAGKAGGSLPTVLNAANEEAVAAFLQGRIAFLAIEEYIERALERHEF
VKEPSLEAIREIDAETRQYVRSLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggattgaaatatataagtatattaggagcgagcggctccatcggcacacagacg
ttggatatcattcgtttgcatccagatgaattccacttaacggcaatatcgattggaaaa
aatgtggacatggcacgagcgattattgaagaatttgccccgcagcttgtcgctgtcgcc
gatgcggacgcgtatgataagctgcggcgcgaatatgcaggaaaagtgaagatcgtttat
ggcgaagatggtttaacggaagcagccgtttttcccaaaacggacatcgttgtgacagcg
gtcgtcggaagcgttggacttgttccgacattgcgggcgattgaagctggcaaaacgatt
gcgttggcgaacaaagaaacgcttgtgacagcagggcatattgtcaccgcagctgccaaa
aagcacggtgttgcgttattgccggtggacagcgaacattcggccatttttcaatgtttg
caaggagaaaagaaaaagaatgtagaaaaaattattttaaccgcgtctggcggcagtttt
cgcgataaaacgagggaagaattaaaaaatgtcacggtggatgaagcgctgcgccatccg
aactggtcgatgggagcgaaaattacgattgattcggcgacaatgatgaacaaagggcta
gaagtgattgaggcacattggcttttcgggctgccgtatgagcaaattgatgtgttgttg
caccgcgaaagcatcattcattcgctcgtccagtttcgcgatacaagcatcatcgctcaa
ctcggaatgccggatatgcatgtgccgattcaatacgctttaacataccctgagcgcttg
ccgctcaaaaatgctaaaccgcttgacttagcagaaattggtgcattacactttcagcag
gtggattttgaccgttatcgctgcctgcgcttagcatatgaagcaggaaaagcgggcggg
tcgctgccaacggtgttaaacgccgcaaacgaagaggcggttgccgcctttttgcaaggc
cgcatcgcatttcttgccattgaggaatatattgaacgcgcgttagagcggcatgagttt
gtcaaagagccgtcgctggaggcgatccgcgaaattgatgcggagacgcgtcagtacgtt
cggtcattactatga

DBGET integrated database retrieval system