KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_2714Help
Entry
Geoth_2714        CDS       T01531                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00020  Citrate cycle (TCA cycle)
gth00640  Propanoate metabolism
gth00660  C5-Branched dibasic acid metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
Module
gth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geoth_2714
   00640 Propanoate metabolism
    Geoth_2714
   00660 C5-Branched dibasic acid metabolism
    Geoth_2714
Enzymes [BR:gth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Geoth_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEH48602
Position
complement(2646864..2648024)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRNYGVSVPNGRVAFTVEEAVEAAKELGSPVCVVKAQIHAGGRGKAGGV
KVAKSLDEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIKKEYYIGFVVDRATSR
VVLMGSEEGGTEIEEVAAKTPEKIFKEYIDPAVGLQAFQARRLAFNINIPKELVNQAAKF
MLGLYQVFVEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRHKDILEYRDLDEEDP
KEVEASKYDLNYIALDGNIGCMVNGAGLAMATMDIIKYYGGEPANFLDVGGGATTEKVTE
AFKIILSDPKVKGIFVNIFGGIMKCDVIANGIVEATKQVGLNLPLVVRLEGTNVELGKKI
LQESGLNIVAAESMADGAQKIVELVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagaaatcctcagaaactacggcgttagcgtgccg
aacggccgcgtagcgtttactgtggaggaagcggtggaggcggcaaaagaattaggaagc
cctgtttgcgtcgtgaaagcgcaaattcacgccggcgggcgcggaaaagccggaggggta
aaagtagcgaaaagcttggatgaagttcgtacatatgcgagcgaactgttagggaaagtg
cttgttacgcatcaaacgggcccagaaggaaaagaagttaagcgcttgcttattgaagaa
ggctgcgacataaaaaaagaatattacatcggttttgttgttgaccgcgcaacttcgcgc
gtcgtattgatgggctcggaagaaggcggaactgaaatcgaagaagtggcggcaaaaacg
ccggagaaaatttttaaagagtacatcgatccagcggtaggtttgcaagcgtttcaagcg
cgccgtttagcgttcaacatcaacattccgaaagagcttgtgaatcaggctgctaaattt
atgttggggctttaccaagtgtttgtcgaaaaagactgctcgatcgcggaaatcaatccg
cttgtcgtgacaggcgacggcaaagtcatggcattggatgcgaaattaaactttgattca
aacgcactgtaccgccataaagacattttagaataccgcgatttagatgaagaagatccg
aaagaagtcgaagcgtcgaaatatgatttaaactatatcgcgcttgacgggaacatcggc
tgcatggttaacggcgccggtttggcgatggcaacgatggatatcatcaaatattacggc
ggcgagccggccaacttcttggacgtcggcggcggcgcaacgacggaaaaagtgacggaa
gcgtttaaaatcatcctttctgatccgaaagtaaaaggaattttcgtcaacattttcggc
ggcattatgaagtgcgatgtcatcgcaaacgggatcgttgaagcaacgaagcaagtcggc
ttaaatcttccgctcgtcgtccgcctggaagggacgaacgtagaattagggaaaaagatt
ttgcaagaatcgggcttaaatattgttgctgctgaatcgatggcagacggcgcccaaaaa
atcgtcgagttagtacgttaa

DBGET integrated database retrieval system