KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_3152Help
Entry
Geoth_3152        CDS       T01531                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00630  Glyoxylate and dicarboxylate metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01200  Carbon metabolism
Module
gth_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Geoth_3152
Enzymes [BR:gth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Geoth_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEH49026
Position
complement(3072841..3074127)
Genome map
AA seq 428 aa AA seqDB search
MASFTERVKQLEESWKDEERWRGVVRPYSAEDVIKLRGSLDIEYTLARRGAEKLWKLLNT
EDYVNALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPSNSVPHVVK
RINQALQRADQIQYLEGSGDIDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAGVHFED
QLSSEKKCGHLGGKVLLPTQTAIRNLIAARLAADVMGVPTVLIARTDANAANLITSDIDP
RDHEFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLEEARRFAEAIHE
KFPGKLLAYNCSPSFNWKKKLDDETIANFQKELGKMGYKFQFVTLAGFHTLNYSMFELAR
GYKERGMAAYAELQQAEFAAEKYGYTATKHQREVGTGYFDEVAQVISGGESSTIALKGST
EEEQFTTA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcaagttttacagaacgtgtcaaacagttggaagaaagttggaaggatgaagagcgt
tggagaggagttgtccgtccgtatagtgcggaagatgtcatcaaattgcgtggctctctg
gatatcgaatatacgttggcgcgccgcggggcggaaaaactttggaagttgttaaatacg
gaagattatgtcaatgcgcttggcgcattaactggaaaccaagcagtccagcaagtgaaa
gcagggctaaaagcaatttacttaagcggatggcaagttgcggctgatgctaaccttgcc
gggcaaatgtatccggaccaaagcttatatccatccaacagcgtgccgcatgtagtaaaa
cggattaatcaagcgttgcaacgcgccgatcaaattcaatatttggaaggaagcggtgat
atcgattatttcgtgccgattgttgccgatgcggaagcaggttttggcggtcaattaaat
gtgtttgaattgatgaaagcgatgattgaagcaggcgctgctggcgttcactttgaagat
cagctttcttcggagaaaaaatgcggtcacttaggcggaaaagtgttgcttccgacgcaa
acggcgatacgcaacttaattgcggcgcgtcttgcggcggatgtcatgggtgtgccgaca
gtgttaattgcccgcacagacgcgaatgcggcgaatttaattacgagcgatattgacccg
cgcgaccatgaatttattactggtgaacggactccagaaggtttttaccgcacgagggca
ggtcttgaccaagcaattgcccgcggcctagcgtatgcgccgtatgcggatttaatctgg
tgcgaaacgagcgagccgaaccttgaagaagcgcgacgctttgcggaagcgattcatgaa
aaattcccgggcaaattgctcgcttacaactgctcgccgtcattcaactggaagaaaaaa
ttggacgacgaaacgattgccaacttccaaaaagaactcggaaaaatgggctacaaattc
cagttcgtcactctcgctggcttccatacgctaaactacagcatgttcgagttggcccgc
ggatacaaagaacgcggcatggcagcatatgcagaattgcaacaggcggaatttgccgca
gaaaaatacggctacaccgctacaaaacatcagcgtgaagtcggtactggttactttgac
gaagtggcacaagtgatttccggcggtgaatcatcgacgattgcgttaaaaggttcgaca
gaagaagaacaattcaccacagcataa

DBGET integrated database retrieval system