KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_3395Help
Entry
Geoth_3395        CDS       T01531                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00020  Citrate cycle (TCA cycle)
gth00620  Pyruvate metabolism
gth00650  Butanoate metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
Module
gth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geoth_3395
   00620 Pyruvate metabolism
    Geoth_3395
   00650 Butanoate metabolism
    Geoth_3395
Enzymes [BR:gth01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Geoth_3395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AEH49254
Position
3305291..3306817
Genome map
AA seq 508 aa AA seqDB search
MDQHISELIANPRLRKRIVTAETAASWIKDGMTLGLSGFTRAGDAKAVPYALIEKAKQQP
LKVNVYTGASLGSDVDKMMAEAGIVNKRLPFQADSVMRKKINEREILFIDQHLSHTAELV
RADVLNPIDFAIVEAIAITEDGMIIPSTSVGNSSIFVNKARHVIVELNTVQPKALKGLHD
IYEAGKQGERNPIPLTKVDDRIGTIGIPVDEDKIIGIVLTNQPDSPSTIVPPDAETAAIA
NHLIHFLRKEVAAGRLSEHLAPIQAGIGSVANAVLYGLLDSEFSNLEVYSEVLQDAMFDL
IDAGKVRFASGCSITLSQNKMKQVYSNLDAYQGKLILRPQEISNHPEIIRRLGLISINTA
LEADIYGNVNSTHVRGTNMMNGIGGSGDFARNARLTIFVTKSIAKNGAISSIVPFVSHVD
HTEHDVDVIITEYGYADLRGLAPMERAPLIIENCAHPSYRPQLREYFKEALKRGGHTPHV
LEKAFAWHVNYEKYGTMLEPQYQLQTQK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
ttggatcaacatatttctgaactcatcgccaatccgcgtttaagaaagcgaattgtaacg
gcggaaacagctgcttcatggataaaagacggcatgacgctcggcttgagcggatttacc
cgcgctggcgatgccaaagcagtcccttatgcattgatcgagaaagcaaaacaacaacct
ttaaaagtaaacgtatatacaggcgcttcacttggctcggacgtggacaaaatgatggca
gaagcaggaatcgtcaacaagcgtcttccgttccaggccgattctgtaatgcgcaaaaaa
attaacgaaagggaaattttgtttattgatcaacatttatcacatacggcggaactagtg
cgtgcagacgtattaaatcctatcgattttgcaattgtggaagcgattgcaataactgaa
gacgggatgatcattccttcaacttccgtaggaaattcatcgatcttcgtgaacaaagcc
agacacgttattgtcgaattaaacacagtccagccaaaggcgctgaaaggacttcatgac
atttatgaagccggcaaacaaggcgaacgaaatccgatacctttgacaaaagtagacgac
cgaatcggcacgattggcatcccagtggatgaggataaaattattggaatcgttctgaca
aaccagcctgattcgccatcgacaatcgtacctccagatgcggaaacggctgcgatcgca
aaccatttaatccattttctccgaaaagaagtggcagccgggagactctccgaacatttg
gcgccgattcaggcaggcataggttctgttgcaaacgctgtcctctacggcttgttagat
tcagaattttctaatttagaagtttattcagaagttcttcaagatgctatgtttgatctc
attgacgcgggaaaagtccgattcgcttccggctgttctattactttgtcgcagaacaaa
atgaaacaagtgtattccaatttggatgcttaccagggcaaacttatccttcgccctcaa
gaaatttctaaccatccagaaatcattcgccgtctcgggctcatttccattaacaccgcc
ttggaagcggatatatacggaaatgttaattcaacgcatgttcgcggcacaaacatgatg
aacggcatcggcggttcaggcgactttgcccgcaatgcgcgccttaccattttcgtgaca
aaatcgattgcaaaaaacggggctatttccagcattgttccattcgtatcacacgtggac
cataccgaacatgacgttgatgtgatcatcacagagtatggctatgccgaccttcgcggg
ctggcgccaatggaacgagcgcctcttatcattgaaaattgcgcgcatccgtcttaccgt
ccgcagttgcgcgaatacttcaaggaagcgcttaagcgcggcggccatacgccacacgtt
cttgaaaaagcattcgcttggcatgtcaattatgaaaaatatggaacaatgctagaacca
caatatcaattgcaaacgcaaaaataa

DBGET integrated database retrieval system