KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_3772Help
Entry
Geoth_3772        CDS       T01531                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00040  Pentose and glucuronate interconversions
gth00052  Galactose metabolism
gth00500  Starch and sucrose metabolism
gth00520  Amino sugar and nucleotide sugar metabolism
gth01100  Metabolic pathways
gth01130  Biosynthesis of antibiotics
Module
gth_M00362  Nucleotide sugar biosynthesis, prokaryotes
gth_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Geoth_3772
   00052 Galactose metabolism
    Geoth_3772
   00500 Starch and sucrose metabolism
    Geoth_3772
   00520 Amino sugar and nucleotide sugar metabolism
    Geoth_3772
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Geoth_3772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: AEH49585
Position
complement(3710420..3711304)
Genome map
AA seq 294 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDNAFELEQLLKQKGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAETPCLKQLIDQYEQTFSSVIGVKRVPDEETHRYGIIDPLEQQGR
RYQVRQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLEKQEAGAGGEIQLTDAIQKLNEIQ
RVFAYEFEGKRYDVGEKIGFIKTTIEFALQYEELRDDLIQFMKEILNDVKMEEK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagtgcgcaaagcgatcatcccggcggcggggctcggaacaagatttttgcca
gcaacgaaagcgatgccgaaagaaatgctcccgatcgtcgataagccaacgattcaatac
attgtcgaagaagcgattgcctctggcattgaagatattatcatcgtcacaggaaaagga
aaacgcgcaatcgaagaccatttcgataacgcgtttgaattggaacagctcttaaagcaa
aaaggaaaactggatttgctcgaaaaggtgaaagagccatcgaaagtcgatattcactac
atccgccaaaaagaaccgaaagggcttggccacgccgtttggtgtgcgcgcaatttcatt
ggcgatgaaccgttcgctgtccttttgggcgatgacatcgttcaagcggaaacaccatgt
ttaaaacagctgatcgatcaatacgaacaaacattcagctcggtcatcggtgtcaaacgg
gttccagatgaagaaacacaccgctacggcattatcgatccgctcgaacaacaaggacgc
cgctaccaagtccgccaatttgtcgaaaaaccagcgccaggcaccgctccgtccaacttg
gcaattatgggaagatacatactgacaccggaaatctttctattccttgaaaaacaagaa
gccggcgccggcggcgaaatccagctcactgacgcgatccaaaagctgaacgaaatccag
cgcgtcttcgcctacgaattcgaaggcaagcgttatgatgtcggagaaaagatcggattt
atcaaaacgacgattgagtttgcgttacagtatgaggaattaagagacgaccttattcaa
tttatgaaggaaatattaaatgatgtgaaaatggaagagaaataa

DBGET integrated database retrieval system