KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_3784Help
Entry
Geoth_3784        CDS       T01531                                 

Definition
(GenBank) Gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00430  Taurine and hypotaurine metabolism
gth00460  Cyanoamino acid metabolism
gth00480  Glutathione metabolism
gth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Geoth_3784
   00460 Cyanoamino acid metabolism
    Geoth_3784
   00480 Glutathione metabolism
    Geoth_3784
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gth01002]
    Geoth_3784
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Geoth_3784
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Geoth_3784
Peptidases and inhibitors [BR:gth01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Geoth_3784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AEH49597
Position
complement(3720650..3722254)
Genome map
AA seq 534 aa AA seqDB search
MDYLHYPYPSRRMVTFAANGMVATSQPLAAQAGLDILKKGGNAIDAAIATAACLTVVEPT
SNGIGGDAFAIVWTNGKLYGLNASGYSPKSISLEAVKERGYTEIPEHGWIPVTVPGAPAA
WAALSKRFGKLPLTEVLKPAIEYAENGYPVSPTLGKYWQAAFQTYKKTLKGPEFASWFAT
FAPNGRAPKIGEIWASKAHAKTLRFIAETNAESFYRGELAEKIAAYSKQYNGFLDIDDLA
EYEVEWVEPISVHYRGYDVWEIPPNGQGLVALMALNIMKGFAVPEAPTAETYHRQIEAMK
LAFADGQAYITDRKHMEHRVEELLSEPFAEMRRALIGEEALLPKPGTPPKGGTVYLAAAD
GDGNMVSFIQSNYMGFGSGLVVPDTGIALQNRGHNFSFDENHVNRLAPRKKPYHTIIPGF
LTKGNEPVGPFGVMGGFMQPQGHLQVVMNTIDFHLNPQAVLDAPRWQWVEGKKVLIEHHF
PHHIAEALERKGHEIHVSLDPGTFGRGQIIWRDPNTGVLVGGTEPRTDGAIAAW
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
ttggactatttgcattatccgtatccgtcgcggcggatggtgacatttgcggctaacggc
atggtggcgacctcgcagccgctggcggcgcaggctggattggacatattaaaaaaaggt
ggaaatgcgatagatgccgcgattgcgactgccgcctgcctgacggtcgttgaaccgacc
tcgaacggcatcggcggcgacgcgtttgcgattgtctggacaaatggcaagctgtatgga
ttaaatgccagcggctattccccaaaatcgatttcgctcgaagcagtaaaagaacgggga
tataccgaaattcccgaacacggctggattccggttaccgttcccggcgcgccggccgct
tgggcggcgctgtcgaaacggttcgggaagctgccgcttaccgaagtgcttaagccggcg
atagaatatgcggaaaacggttatccagtgtctccgacgctggggaagtattggcaagcg
gcatttcaaacgtacaaaaaaacgcttaagggcccggaatttgccagttggtttgcgacg
ttcgcgccaaacgggcgcgcgccgaaaatcggggaaatatgggcatccaaagcgcatgct
aagacgctccgcttcatcgcggaaacgaacgcggaaagcttttacagaggggaattggcg
gaaaaaatcgcggcgtactctaaacaatacaatggttttttagatatcgacgatttagcg
gaatacgaagtggaatgggtcgagccgatttctgttcattaccgcggttatgacgtatgg
gaaattccgccgaacggccaagggcttgtcgcgttaatggcgttgaacatcatgaaaggg
tttgccgttccggaagcgccgacggcggagacataccaccggcaaatcgaagcgatgaaa
ctggcgtttgctgatggacaggcatatatcacggatcgcaagcatatggagcatcgtgtc
gaggaattgctgtccgagccgtttgccgaaatgaggcgggcgctgattggcgaagaggca
ttgcttccaaagccgggaacgccgccaaaaggcggcacggtctatttggcggcagcggac
ggcgacggcaatatggtgtccttcattcaaagcaattacatggggtttggctcggggctg
gtcgtgccggataccggcatcgccctgcaaaaccgcgggcataatttctcctttgacgaa
aatcatgtcaaccggttggcgccgcggaaaaaaccataccatacgatcattccgggattt
ttgacaaaagggaacgagccggtcgggccgttcggcgtcatgggcgggtttatgcagccg
caagggcatttgcaagtcgtaatgaacacgatcgacttccatctcaatccgcaagcggtg
ctcgatgcgccaagatggcaatgggtggaaggcaaaaaagtgctcattgaacatcatttt
ccgcatcatatcgccgaagcgctggaacgaaaagggcatgaaatccatgtttcccttgat
ccgggaacattcgggcgcggtcaaatcatttggcgcgatccgaacaccggagtgctcgtc
ggcggaacggaaccgcgcaccgatggggcgatcgcggcatggtaa

DBGET integrated database retrieval system