KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_03210Help
Entry
GT3570_03210      CDS       T04710                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00061  Fatty acid biosynthesis
gtk00071  Fatty acid degradation
gtk01100  Metabolic pathways
gtk01212  Fatty acid metabolism
gtk02024  Quorum sensing
Module
gtk_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GT3570_03210
   00071 Fatty acid degradation
    GT3570_03210
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GT3570_03210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gtk01004]
    GT3570_03210
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gtk04147]
    GT3570_03210
Enzymes [BR:gtk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GT3570_03210
Lipid biosynthesis proteins [BR:gtk01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GT3570_03210
Exosome [BR:gtk04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GT3570_03210
  Exosomal proteins of breast cancer cells
   GT3570_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AMV09954
UniProt: A0A1C3DA62
Position
611910..613454
Genome map
AA seq 514 aa AA seqDB search
MNVTTRLAQIAKQLPDKEAYVFMKERCTYQQLDEAISRFADGLARLGVRRGDHIALLLGN
SPQFVIGLYGALRLGATVIPINPIYTPEEISYILHNGDVKAVIGLDLLAPLFVEAKKRLP
LLEHAIVCETPEGKEKGVSLSEGMKSFAEVLADGSPDFTGPELGDDDVAVILYTSGTTGK
PKGAMLTHKNIYSNAQDTADYLGINENDRVIAALPMFHVFCLTVALNAPLMNGGTVLIMP
KFSPAKLFQLAREEKATIFAGVPTMYNFLYQYEGGSADDLRTLRLCISGGASMPVALLEN
FEKKFNVIISEGYGLSEASPVTCFNPLDRPRKPGSIGTNIKNVENKVVNEYGEEVPVGEV
GELVVRGPNVMKGYYKMPEETSAALRDGWLHTGDLARMDEDGYFYIVDRKKEMIIVGGYN
VYPREVEEVLYSHPDVVEAAVIGVPDPDYGEAVRAYVVAKNPELTEAELIAYCRERLAKY
KVPSAIDFLDELPKNATGKILRRALKERLASSHA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaacgacgcggttggcgcaaatcgctaagcagttgccggacaaggaagcgtat
gtgttcatgaaagagcggtgcacgtatcaacaattggacgaagccatttcccgatttgcc
gacgggttggcgcggcttggcgttcgccgaggcgaccatatcgccttgttgcttggcaac
tcgccgcagtttgtcatcggcttgtacggggcgttgcggcttggggcgaccgtcattccg
atcaatcccatttacacgcccgaggaaatttcttatattttgcacaacggcgacgtcaag
gcggtgatcggcctcgacttgctcgctccgttgtttgtggaggcgaagaagcggcttccg
ctgctcgagcatgcgatcgtttgtgaaacgccggaagggaaggagaaaggtgtttcgctg
tcggaagggatgaaatcgtttgcagaagtgttggcggacggcagcccggactttaccgga
cctgaactgggtgatgacgatgtcgccgtcattttgtacacatcggggacgaccggcaag
ccgaaaggggcgatgctcactcataaaaacatatacagcaatgcgcaagatacggctgat
tatttaggcatcaatgaaaacgatcgcgtcatcgccgcgttgccgatgtttcatgtcttt
tgcttgaccgtggcgctcaatgccccgctgatgaacggcggaacggtgctcatcatgcca
aagttcagcccagcaaagttgtttcagctagcccgagaggaaaaagcgacgatttttgcc
ggcgtgccgacgatgtacaatttcctttatcagtacgaaggtggaagcgcggacgatttg
cggacgctccgcctttgcatctcaggaggcgcttcaatgccggtcgctttgcttgaaaac
tttgagaaaaagttcaacgtcatcatttcggaaggatatgggctttcggaggcgtcccct
gtcacctgctttaatccgctcgatcggccgcgcaagcctggttcgattggaacgaacatt
aaaaacgttgaaaataaggtcgtcaacgaatacggagaagaagtgcccgtcggcgaagtt
ggcgagcttgtcgttcgcgggccgaacgtcatgaaagggtactacaaaatgcctgaagag
acctcggccgccttgcgcgacggctggctgcacaccggtgatttggcgcgcatggacgag
gacggctatttctacatcgtcgaccgaaagaaagagatgattatcgtcggcggctacaac
gtgtatccacgcgaagtcgaagaagtgctgtacagccatccggatgtcgttgaagccgcg
gtgatcggcgtgccggacccggattacggagaggcggtgcgggcgtatgtcgtcgcgaaa
aatccggagttgacggaagcagagctcattgcttactgccgtgagcggttggcaaaatat
aaagtgccgagcgcgattgactttttggacgagctgccgaaaaatgcgacaggaaaaatt
ttgcgaagagcgttaaaagagcggctcgcgtcttcccatgcttga

DBGET integrated database retrieval system