KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_05285Help
Entry
GT3570_05285      CDS       T04710                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00471  D-Glutamine and D-glutamate metabolism
gtk00550  Peptidoglycan biosynthesis
gtk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GT3570_05285 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GT3570_05285 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gtk01011]
    GT3570_05285 (murD)
Enzymes [BR:gtk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     GT3570_05285 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:gtk01011]
 Precursor biosynthesis
  Amino acid ligase
   GT3570_05285 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_3 NAD_binding_7 Cytochrom_C552
Motif
Other DBs
NCBI-ProteinID: AMV10360
UniProt: A0A2Z3N6U1
Position
1040643..1041998
Genome map
AA seq 451 aa AA seqDB search
MKPTRFYQHRRVLVIGLAKSGAAAARLLAELGAKVVVNDQKPLSENMEAKQLEPLGIRVV
CGGHPLELLDEPFDLVVKNPGIPYTNPMVKKALEKGLPVVTEVELAYHISEGPFIGITGS
NGKTTTTTLIYEMLKADGQDPLLAGNIGLVACEVAREAKPGQWLVTELSSFQLAGIDKFR
PAIAVLLNIFDAHLDYHGTKEAYAAAKANIFRNQTERDYAVVNADDPLVMNIASSVRSQK
VLFSATKLLGEGAYVQDGAIYWNGDPVIRIADIVLPGQHNLENILAAVAAAKLAGASDEA
IRQVLATFSGVKHRLQYVAEIDGRRFYNDSKATNILATQKALSAFAGEPVILLAGGLDRG
NEFDDLLPYLQQVKAVVLFGQTADKIGRIAQKAGIETIRYVDNVEKAVPVAFELSEPGDV
ILLSPACASWDQYKTFEERGDIFINAVHKLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccgactcgtttttatcaacatcgtcgtgtgcttgtcattggattggcgaaaagc
ggagcggcggcagctcggcttcttgcggagttaggcgctaaggtcgtcgtcaatgatcaa
aagccgctttcggaaaacatggaggccaagcagcttgaaccgctgggcattcgcgtcgtt
tgcggcggtcatccgcttgaactgcttgatgagccgtttgaccttgtcgtgaaaaacccg
ggcattccgtacacgaacccgatggtgaaaaaggcgcttgagaaggggcttccggttgtg
accgaagtggagcttgcttatcacatttccgaagggccgtttatcggcatcaccgggtcc
aacggaaaaacgacgacgacgacgctcatttacgaaatgttaaaagcggacggccaagat
ccgctgcttgccggcaacatcggccttgtcgcctgcgaggtggcgagggaagcgaagccg
gggcaatggcttgtcacggaactgtcttcgttccagcttgccggcattgacaagtttcgc
ccagccattgcggttttgctcaatattttcgacgcccacttggactaccacggaacgaaa
gaggcgtatgcagcggcaaaggcgaacattttccgcaatcaaacggagcgcgattatgcc
gtcgtcaatgccgacgatccgctcgtgatgaacattgcctcctcggttcgatcgcaaaaa
gtgctgttttcggcgacgaagcttcttggcgaaggggcgtacgttcaagatggcgccatc
tattggaacggtgatccagttatcagaatcgctgacatcgttcttcctggacagcacaat
ttggaaaacattttagcggcggtggcggccgccaagctggccggcgccagtgatgaggcg
atccgccaggtgctggcgacgttttccggcgtgaaacatcggcttcagtatgtggcggaa
attgacggccggcggttttacaacgactcgaaagcgacgaacatcttagcgacgcaaaag
gcgctttcagcgtttgccggcgagccggtcattttgctcgctggcgggcttgaccgcggc
aatgagtttgatgatcttctcccgtatttgcaacaggtgaaggcggtcgtactgttcggc
cagacggcggataaaatcggccgcatcgcccaaaaagcgggaatagaaacgatccgatat
gtcgataatgtggaaaaagccgtcccggttgctttcgagctttccgaaccgggcgacgtc
attttgctctctccagcatgcgccagctgggatcaatacaaaactttcgaggagagaggg
gacatttttatcaatgccgtgcataagttgaaatag

DBGET integrated database retrieval system