KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_08535Help
Entry
GT3570_08535      CDS       T04710                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00480  Glutathione metabolism
gtk00590  Arachidonic acid metabolism
gtk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    GT3570_08535
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GT3570_08535
Enzymes [BR:gtk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GT3570_08535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AMV10981
UniProt: A0A2Z3NDU8
Position
complement(1696190..1696666)
Genome map
AA seq 158 aa AA seqDB search
MSVYEFSAKTIRGEEQPLSVYRGNVLLIVNTASRCGFTPQYKELQELYDEYRDRGFVVLG
FPCNQFGGQEPGTEEEIEQFCQLNYGVTFPLFAKVDVNGDHAHPLFQYLKEEAPGALGTK
AIKWNFTKFLVDRNGKVVARFAPQTKPSELRKEIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatatgaattcagcgccaaaaccattcgcggagaggaacaaccgctttccgtc
tatcgaggcaacgtgctgttgattgtcaacacggcgagccgttgcggcttcaccccgcag
tataaagaactgcaggagctgtatgacgaatatcgcgatcgcgggtttgttgtgctcggc
tttccgtgcaaccagttcggcggccaagagccggggacggaagaggaaatcgagcaattt
tgccagttgaattatggtgtgacgttcccgctgtttgcgaaagtggatgtgaatggcgat
cacgcccatccgctgtttcaatatttgaaagaagaggcgccgggggcattgggaacaaag
gcgatcaaatggaatttcacgaagtttttggtcgaccgcaacggcaaggttgtagctcgt
ttcgcaccgcaaacaaagccaagcgagctgagaaaggaaattgaaaagctgctgtaa

DBGET integrated database retrieval system