KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_10485Help
Entry
GT3570_10485      CDS       T04710                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gtk01100  Metabolic pathways
gtk01110  Biosynthesis of secondary metabolites
gtk01130  Biosynthesis of antibiotics
gtk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GT3570_10485
Enzymes [BR:gtk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GT3570_10485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NMO FMN_dh
Motif
Other DBs
NCBI-ProteinID: AMV11345
UniProt: A0A1C3D756
Position
complement(2106169..2106945)
Genome map
AA seq 258 aa AA seqDB search
MLEQILAAKREEVETLTLPAPLPERKRRPFAAALRRPRRMLGLIAEVKKASPSKGIIRPN
FDPVAIAKAYERAGADAISVLTDERYFQGHRRYLRAVKEAVNVPVLRKDFIIDRRQVEES
VRLGADAILLIGEALPPETLEELYHEAYSLGLECLVEVHAKETLERIFDRFTPEIVGINN
RDLHTFVTTLEATKTLAPLIPPSCVIVSESGIGSFNDVKTVKSYGAQAMLVGESLMRQDD
VERAVYRLFGEEDGDDSN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagcaaattttagcagccaaacgggaagaagtggaaacgttgacgctgccggcg
ccattgccagagcgaaagcgccggccatttgcggcggcgctccgtcggccgcggcggatg
cttggcttgatcgctgaggtgaaaaaagcgtcgccgtcaaaaggcatcattcgcccgaat
tttgacccggtggccatcgcgaaagcatatgagcgcgccggtgccgacgcgatcagcgtg
ctgacggatgaacggtatttccaagggcatcgccgctatttgcgagcggtgaaagaagcg
gttaacgttcccgtgctgcgcaaagatttcatcatcgatcggcggcaagtcgaggaaagc
gtccgactcggggcggatgcgattttattgatcggcgaggcgctcccgccggaaacactc
gaggagctctatcatgaagcgtacagcttggggctcgaatgtctggtcgaggtgcatgca
aaagagacgctcgagcggattttcgatcggtttacgccggagatcgtcggcatcaacaac
cgcgacttgcatacctttgtgacaacacttgaggcgaccaaaacgctcgctccgctcatc
ccgccatcgtgcgtcatcgtcagcgaaagcgggatcggttccttcaatgatgtgaagacg
gtcaaatcgtacggagcgcaggccatgctcgtcggcgagtcgctcatgcgccaagatgat
gtggagcgagcggtctaccggctgtttggggaggaagatggggatgattcgaattaa

DBGET integrated database retrieval system