KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_14390Help
Entry
GT3570_14390      CDS       T04710                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    GT3570_14390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMV12101
UniProt: A0A2Z3N8C3
Position
complement(2848386..2849384)
Genome map
AA seq 332 aa AA seqDB search
MDTILILTICIVIFALAFDFINGFHDTANAIATSVSTRALTPRQAIILAATMNFIGALTF
TGVAKTITKDIVDPFALENGPLIILAALTSAIAWNLITWYYGIPSSSSHAIIGSVAGAAI
SAAGVGILNYGGFLKILQSLILSPFLALGVGFIIMSIFRFIFKNANLYSTTRGFRMFQIV
TAAFQAYTHGTNDAQKAMGIITMALIAGGYHATTDIPEWVRISAALAMGLGTAVGGWKII
KTVGGKIMKIRPINGAAADLSSALVILSATMFHLPVSTTHVISSAIMGVGAAQRVKGVKW
GVARRIVLTWIITLPVSALIAGFVYQVLRLFF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacgatcctgattttaacgatctgcatcgtcattttcgcattggcgtttgacttt
atcaacggctttcacgatacggccaacgccattgccacatcggtgtcgacaagggcgctc
acgccgcgtcaagccattattttggctgcgacgatgaactttatcggcgcgctcaccttt
accggcgtcgcaaaaacgattacgaaagacattgtcgacccgtttgcgctagaaaatgga
ccactcattattttagcagcgttgacatcagccattgcctggaatttgatcacgtggtat
tacggcattccgagcagctcttcgcacgcgatcatcggttcggtcgccggagcggcgatt
tccgcggctggggttgggattttgaattacggcgggtttttgaaaattttacaatcgctg
attctttccccgtttttggcgttaggggtcggctttatcattatgagcatttttcgtttt
atctttaaaaacgccaacttatacagcacgacgaggggctttcggatgtttcaaattgtg
accgcggcgtttcaggcgtatacgcacggaacaaacgacgctcaaaaagcgatggggatc
attacgatggcgttaatcgccggaggataccacgcgacgaccgacattcctgaatgggtg
cgcatttctgccgccttggccatgggattgggaacggctgttggtgggtggaagatcatt
aaaacggtcggtggaaaaattatgaaaattcgtccgatcaacggagcggcggctgatttg
tcgtccgcactcgtcattctttcagcgacgatgttccacttgccagtcagcacgacgcac
gtcatttcctcggccatcatgggggtcggcgccgcccaacgggtgaaaggcgtcaaatgg
ggcgtcgctcgccgcattgtgctgacatggatcatcaccttgccagtgtcagcgttgatt
gctgggtttgtgtaccaggttctccgtttatttttctaa

DBGET integrated database retrieval system