KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_14500Help
Entry
GT3570_14500      CDS       T04710                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00627  Aminobenzoate degradation
gtk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GT3570_14500
Enzymes [BR:gtk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     GT3570_14500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Acid_phosphat_B Hydrolase_3 CdiI_3
Motif
Other DBs
NCBI-ProteinID: AMV12123
Position
complement(2868500..2869270)
Genome map
AA seq 256 aa AA seqDB search
MKRYNGYLIDLDGTMYRGTECIAEARTFVNELHRRGIPYLFVTNNSSRTPAQVAEKLRSF
GVPAEEKHVFTTSQATANYIFEKKPDASVYVIGEEGLQTALADKGFRLAGEDADVVVIGI
DRQITYEKFAVACLAVRNGAMFISTNGDIALPTERGLLPGNGALTSVVAVSTQVKPTFIG
KPEKIIMEQALKVLGVPKEDVLMIGDYYETDILAGMNAGIDTLLVHTGVTTKEMLARYER
MPTYTADSLLEWLDRL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgatacaacggctacctcatcgatttggacgggacgatgtaccgcggcaccgaa
tgcatcgctgaggcgcgtacgtttgtcaacgagctgcaccgccgtggcattccgtatttg
tttgtcacgaacaattcgtcgcgcacaccggcgcaagtggcggaaaaattgcgttcgttc
ggcgtgccggccgaggagaagcatgtgtttacgacaagccaggcgacggcgaattacatt
tttgaaaaaaaaccggatgcttccgtgtatgtgatcggtgaagaagggctccaaaccgcc
ttggcggacaaaggattccgtttggccggcgaagatgcggatgtcgtcgtcatcgggatt
gaccggcaaattacatacgaaaagttcgctgtcgcttgtctcgctgtccgaaatggagcg
atgttcatctcaaccaacggcgacatcgccttgccgacggagcgggggctgcttccgggc
aacggggcgctgacgtcggtcgtcgctgtatcgacgcaggtgaagccgacatttatcggc
aagccggaaaaaatcattatggagcaggcgctcaaagtgcttggcgtcccgaaggaggac
gtgctgatgatcggcgactattatgaaaccgacattttagccggcatgaacgctggcatt
gatacgcttttagtccatacgggcgttacgacaaaagaaatgctcgcccgctacgaacgg
atgccgacgtatacggctgattcacttttggaatggcttgaccgcttgtaa

DBGET integrated database retrieval system