KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_16630Help
Entry
GT3570_16630      CDS       T04710                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00010  Glycolysis / Gluconeogenesis
gtk00030  Pentose phosphate pathway
gtk00051  Fructose and mannose metabolism
gtk00680  Methane metabolism
gtk01100  Metabolic pathways
gtk01110  Biosynthesis of secondary metabolites
gtk01120  Microbial metabolism in diverse environments
gtk01130  Biosynthesis of antibiotics
gtk01200  Carbon metabolism
gtk01230  Biosynthesis of amino acids
Module
gtk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gtk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
gtk_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT3570_16630
   00030 Pentose phosphate pathway
    GT3570_16630
   00051 Fructose and mannose metabolism
    GT3570_16630
  09102 Energy metabolism
   00680 Methane metabolism
    GT3570_16630
Enzymes [BR:gtk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GT3570_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase 4HFCP_synth
Motif
Other DBs
NCBI-ProteinID: AMV12534
UniProt: A0A1C3D7H2
Position
complement(3295303..3296166)
Genome map
AA seq 287 aa AA seqDB search
MPLVSMKEMLNEALRGKYAVGQFNINNLEWTQAILAAAEEEKSPVILGVSEGAARYMSGF
KTVVNMVKGLMEDMNITVPVAIHLDHGSSFEKCKAAIDAGFTSVMIDASHHPFEENVRIT
SQVVEYAHARGVSVEAELGIVGGQEDDVVGEGIIYADPKECEELVKRTGVDCLAPALGSV
HGPYKGEPKLGFAEMEQIRDLTGVPLVLHGGTGIPTEQIQRAISLGTSKINVNTENQMAF
TKVVRELLAKDPNVYDPRKIIGPGRDAIKATVIGKMREFGSSGKAAR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagtatcgatgaaagagatgctcaacgaggcgctgcgcggcaaatacgcggtc
ggtcaatttaacattaacaacttggaatggacacaagccattttagcggcggccgaagag
gaaaaatcgccggtcattctcggcgtctccgaaggggcggcccgctatatgagcggattc
aaaacggtcgtcaatatggtcaaagggttaatggaagacatgaacatcaccgttccggtc
gccatccatctcgaccatggatcgagctttgaaaaatgcaaagcggcgattgacgccggg
ttcacctcggttatgattgacgcctcccaccatccatttgaagaaaacgtccgcatcacc
tcgcaagtcgttgaatatgctcatgcgcgcggcgtttcggtcgaagcggagctcggcatc
gtcggcgggcaggaagacgacgtcgtcggagaagggatcatttacgccgacccgaaagag
tgcgaagagcttgtcaaacggacaggcgtcgactgtctcgccccggcgctcggttctgtg
cacggcccgtacaaaggagagccgaagctcggatttgccgaaatggagcaaatccgcgat
ttaaccggcgttccgcttgtgctccacggcggcaccggcattccgaccgaacaaattcaa
cgcgcgatctcccttggcacatcgaaaatcaacgtcaataccgaaaaccaaatggcgttt
accaaagtcgtccgcgaactgctcgcgaaagacccgaacgtctatgatccgcgcaaaatc
atcggcccgggccgcgacgccatcaaagcgacggtcatcggcaaaatgcgcgagtttggc
tcgtccggaaaagcggcgcgatga

DBGET integrated database retrieval system