KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_16680Help
Entry
GT3570_16680      CDS       T04710                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00071  Fatty acid degradation
gtk00072  Synthesis and degradation of ketone bodies
gtk00280  Valine, leucine and isoleucine degradation
gtk00310  Lysine degradation
gtk00362  Benzoate degradation
gtk00380  Tryptophan metabolism
gtk00620  Pyruvate metabolism
gtk00630  Glyoxylate and dicarboxylate metabolism
gtk00640  Propanoate metabolism
gtk00650  Butanoate metabolism
gtk00900  Terpenoid backbone biosynthesis
gtk01100  Metabolic pathways
gtk01110  Biosynthesis of secondary metabolites
gtk01120  Microbial metabolism in diverse environments
gtk01130  Biosynthesis of antibiotics
gtk01200  Carbon metabolism
gtk01212  Fatty acid metabolism
gtk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GT3570_16680
   00630 Glyoxylate and dicarboxylate metabolism
    GT3570_16680
   00640 Propanoate metabolism
    GT3570_16680
   00650 Butanoate metabolism
    GT3570_16680
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GT3570_16680
   00072 Synthesis and degradation of ketone bodies
    GT3570_16680
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GT3570_16680
   00310 Lysine degradation
    GT3570_16680
   00380 Tryptophan metabolism
    GT3570_16680
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GT3570_16680
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GT3570_16680
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GT3570_16680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gtk04147]
    GT3570_16680
Enzymes [BR:gtk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GT3570_16680
Exosome [BR:gtk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GT3570_16680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD DUF2496
Motif
Other DBs
NCBI-ProteinID: AMV12544
Position
complement(3308708..3309886)
Genome map
AA seq 392 aa AA seqDB search
MGKTVIVSGARTPFGKLGGSLQALSASELGGIAVKEALARADVSAEQVDHVILGTVLQGG
QGQLPSRQAMRHAGIPWHVRTETVNKVCASGMRAVTLADQLIRLGDADVVVAGGMESMSN
APYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGNTARELGITREAQDEWAY
RSHMRAIAAIEAGRLAEEIVPVTIPQRKGEPLVVEHDEAPRKDTSLEALAKLPPVFDPEG
TITAGNAPGVNDGAAALVLMSEERAAREGLEPLATVVAHTAIAVEAKDFPKTPGLVINEL
LRKTGKTVDDIALFEINEAFAAVALAAIQIAGLDPEKVNVNGGAVALGHPIGASGARIIL
TLIYELKRRGGGLGIAAICSGGGQGDAILVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaacagtgattgtcagcggggcgcgcaccccgttcggaaaactcggcggttct
ttgcaagcgctgtcagcgtcagaactcggcggcattgccgtgaaagaagcgcttgcccgc
gcggatgtgagcgcggaacaagtcgatcatgtcattttaggcaccgtcttgcaaggcgga
caaggacagctcccatcgcggcaggcgatgcgccatgccggcattccgtggcatgttcgc
accgagacggtcaataaagtatgcgcatcgggcatgcgcgccgtgacgctcgcggatcag
ctcatccgcttaggcgacgccgatgtcgttgtcgcgggcgggatggaatcgatgagcaac
gccccgtacgtgctgccgaaagcgcgctgggggttgcgaatgggcgacagcacggtgaag
gatttaatggtgtatgatggcttgacatgcagttttaccggcgtccatatgggcgtttat
ggcgggaatacagcgcgtgaacttggcattacacgcgaggcgcaggatgagtgggcgtac
cgcagccatatgcgagccattgccgccatcgaagccggtcggctcgcggaagagatcgtt
ccggtgacgattccgcagcgcaaaggagagccgcttgtcgtcgaacacgacgaggcgccg
cgcaaagacacgtcgcttgaagcgttggcgaaactgccgccggtgtttgacccggaagga
acgatcactgccggcaacgccccgggcgtcaacgacggcgccgcggcgctcgtcttgatg
agcgaggagcgcgccgcccgcgaggggcttgagccgctcgcgactgttgtcgcccacacc
gccatcgccgttgaggcgaaagatttcccaaaaacgccgggacttgtcatcaacgagctg
ctccgcaaaacgggaaaaacggtcgacgacattgccttgttcgaaataaacgaagcgttt
gccgctgttgctcttgctgcgatccaaatcgccggccttgacccggaaaaagtgaacgtc
aacggcggcgctgtcgccctcggccacccgatcggcgcgagcggcgcacgcatcatcctc
acgctcatttatgagctgaaacgccgcggcggcggcctcggcatcgccgccatctgcagc
ggcggcggccaaggcgacgccatcttggtcgaggtataa

DBGET integrated database retrieval system