KEGG   Geovibrio thiophilus: EP073_07480Help
Entry
EP073_07480       CDS       T05803                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
gtl  Geovibrio thiophilus
Brite
KEGG Orthology (KO) [BR:gtl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EP073_07480
Enzymes [BR:gtl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     EP073_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP HTH_WhiA
Motif
Other DBs
NCBI-ProteinID: QAR33247
UniProt: A0A410JYJ2
Position
1576567..1577406
Genome map
AA seq 279 aa AA seqDB search
MIDLHCHSVFSDGTKTPAEIVRMADSKRIRHIALTDHDTVAGLPDFFAAKGNAERIAGTE
ISIDFSPGTMHVVGLFIDYKSAELTAKLGELLIARKERNDSMLKEVSRLVDREITENEVS
TSNLGELGRPHIAKFLIREGVVADMEEAFDKYLAKGKPIYRERKRFSFEESAEMIHAAGG
ITILAHPFSMRLEKDAYLPYIKGMTDKGLDAVETYCSYHSEEDTLFFNDLTKKLGLPVSA
GSDYHGENKTNVKLGKWNCRLHNPENVLYALRKKAEQYR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatagatctccattgtcactcggttttttcagacggaaccaagactcccgcagagatt
gtaaggatggcggattccaagaggataaggcatatagcgctcactgaccatgatacggtt
gccggtcttcctgattttttcgccgctaaagggaatgcggagcgtatcgcgggcacggag
ataagcattgatttctcgcccggcactatgcacgttgtggggctgtttatagactacaaa
agcgcggagctgaccgcaaaactcggagagctgctaatcgccagaaaagaaaggaatgac
agcatgcttaaagaagtcagcaggcttgtagacagggagattacggagaatgaggtcagc
acatcgaaccttggcgaactcggcagaccgcatatagcgaagtttcttataagagaaggc
gttgtggcggatatggaagaggcgttcgacaaatacttagccaaaggtaagccgatttac
agagagaggaaacgcttcagctttgaggaaagcgcggagatgatacacgcagcagggggt
ataacaatactcgcccatccgttcagcatgcgtttggagaaggatgcttacctgccttat
atcaaagggatgacggataaggggcttgacgccgttgagacttactgctcgtaccattcc
gaagaggataccttgtttttcaatgacttgacaaagaaactcggactccctgtctccgcc
ggaagcgattaccacggcgaaaacaaaacaaacgtcaagctgggcaaatggaactgccgt
ctgcacaaccccgaaaatgttttgtacgctttaaggaagaaggcggagcagtacaggtga

DBGET integrated database retrieval system